Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 119366..119792 | Replicon | plasmid pRIVM_C019217_2 |
| Accession | NZ_CP087378 | ||
| Organism | Escherichia coli strain RIVM_C019217 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LN359_RS26100 | Protein ID | WP_001372321.1 |
| Coordinates | 119366..119491 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 119568..119792 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LN359_RS26060 (114405) | 114405..114632 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| LN359_RS26065 (114726) | 114726..115412 | - | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| LN359_RS26070 (115606) | 115606..115989 | - | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LN359_RS26075 (116275) | 116275..116922 | + | 648 | WP_124760006.1 | transglycosylase SLT domain-containing protein | - |
| LN359_RS26080 (117219) | 117219..118040 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| LN359_RS26085 (118160) | 118160..118447 | - | 288 | WP_000107537.1 | hypothetical protein | - |
| LN359_RS26090 (118745) | 118745..118918 | + | 174 | Protein_145 | hypothetical protein | - |
| LN359_RS26095 (118916) | 118916..119146 | - | 231 | WP_071587244.1 | hypothetical protein | - |
| LN359_RS26100 (119366) | 119366..119491 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LN359_RS26105 (119433) | 119433..119582 | - | 150 | Protein_148 | plasmid maintenance protein Mok | - |
| - (119568) | 119568..119792 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (119568) | 119568..119792 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (119568) | 119568..119792 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (119568) | 119568..119792 | - | 225 | NuclAT_0 | - | Antitoxin |
| LN359_RS26110 (119604) | 119604..119792 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| LN359_RS26115 (119761) | 119761..120523 | - | 763 | Protein_150 | plasmid SOS inhibition protein A | - |
| LN359_RS26120 (120520) | 120520..120954 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| LN359_RS26125 (121009) | 121009..122967 | - | 1959 | WP_229327587.1 | ParB/RepB/Spo0J family partition protein | - |
| LN359_RS26130 (123026) | 123026..123259 | - | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
| LN359_RS26135 (123315) | 123315..123842 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| LN359_RS26140 (124312) | 124312..124560 | - | 249 | WP_071606928.1 | hypothetical protein | - |
| LN359_RS26145 (124482) | 124482..124712 | - | 231 | WP_001333093.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | - | 1..147403 | 147403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T225419 WP_001372321.1 NZ_CP087378:c119491-119366 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T225419 NZ_CP121147:c2755895-2755793 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 225 bp
>AT225419 NZ_CP087378:c119792-119568 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|