Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2062859..2063081 | Replicon | chromosome |
Accession | NZ_CP087290 | ||
Organism | Escherichia coli strain APEC 102026 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | LO741_RS09980 | Protein ID | WP_001295224.1 |
Coordinates | 2062859..2062966 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2063023..2063081 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LO741_RS09960 | 2058205..2059185 | - | 981 | WP_000019440.1 | IS5-like element ISKpn26 family transposase | - |
LO741_RS09965 | 2059337..2060908 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
LO741_RS09970 | 2060905..2061096 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
LO741_RS09975 | 2061093..2062772 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
LO741_RS09980 | 2062859..2062966 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2063023..2063081 | + | 59 | - | - | Antitoxin |
LO741_RS09985 | 2063342..2063449 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
LO741_RS09990 | 2063825..2063932 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
LO741_RS09995 | 2064308..2064415 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
LO741_RS10000 | 2064891..2066162 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
LO741_RS10005 | 2066192..2067196 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2058205..2059185 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T225259 WP_001295224.1 NZ_CP087290:c2062966-2062859 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T225259 NZ_CP121087:3299547-3299732 [Escherichia coli]
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
Antitoxin
Download Length: 59 bp
>AT225259 NZ_CP087290:2063023-2063081 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|