Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1265706..1265928 Replicon chromosome
Accession NZ_CP087136
Organism Escherichia coli strain JW5503

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag LOX89_RS06245 Protein ID WP_000170963.1
Coordinates 1265706..1265813 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1265861..1265928 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOX89_RS06215 (1261015) 1261015..1262097 + 1083 WP_000804726.1 peptide chain release factor 1 -
LOX89_RS06220 (1262097) 1262097..1262930 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
LOX89_RS06225 (1262927) 1262927..1263319 + 393 WP_000200374.1 invasion regulator SirB2 -
LOX89_RS06230 (1263323) 1263323..1264132 + 810 WP_001257044.1 invasion regulator SirB1 -
LOX89_RS06235 (1264168) 1264168..1265022 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LOX89_RS06240 (1265171) 1265171..1265278 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1265326) 1265326..1265392 + 67 NuclAT_34 - -
- (1265326) 1265326..1265392 + 67 NuclAT_34 - -
- (1265326) 1265326..1265392 + 67 NuclAT_34 - -
- (1265326) 1265326..1265392 + 67 NuclAT_34 - -
- (1265326) 1265326..1265392 + 67 NuclAT_36 - -
- (1265326) 1265326..1265392 + 67 NuclAT_36 - -
- (1265326) 1265326..1265392 + 67 NuclAT_36 - -
- (1265326) 1265326..1265392 + 67 NuclAT_36 - -
- (1265326) 1265326..1265392 + 67 NuclAT_38 - -
- (1265326) 1265326..1265392 + 67 NuclAT_38 - -
- (1265326) 1265326..1265392 + 67 NuclAT_38 - -
- (1265326) 1265326..1265392 + 67 NuclAT_38 - -
- (1265326) 1265326..1265392 + 67 NuclAT_40 - -
- (1265326) 1265326..1265392 + 67 NuclAT_40 - -
- (1265326) 1265326..1265392 + 67 NuclAT_40 - -
- (1265326) 1265326..1265392 + 67 NuclAT_40 - -
- (1265326) 1265326..1265392 + 67 NuclAT_42 - -
- (1265326) 1265326..1265392 + 67 NuclAT_42 - -
- (1265326) 1265326..1265392 + 67 NuclAT_42 - -
- (1265326) 1265326..1265392 + 67 NuclAT_42 - -
- (1265326) 1265326..1265392 + 67 NuclAT_44 - -
- (1265326) 1265326..1265392 + 67 NuclAT_44 - -
- (1265326) 1265326..1265392 + 67 NuclAT_44 - -
- (1265326) 1265326..1265392 + 67 NuclAT_44 - -
- (1265328) 1265328..1265393 + 66 NuclAT_18 - -
- (1265328) 1265328..1265393 + 66 NuclAT_18 - -
- (1265328) 1265328..1265393 + 66 NuclAT_18 - -
- (1265328) 1265328..1265393 + 66 NuclAT_18 - -
- (1265328) 1265328..1265393 + 66 NuclAT_21 - -
- (1265328) 1265328..1265393 + 66 NuclAT_21 - -
- (1265328) 1265328..1265393 + 66 NuclAT_21 - -
- (1265328) 1265328..1265393 + 66 NuclAT_21 - -
- (1265328) 1265328..1265393 + 66 NuclAT_24 - -
- (1265328) 1265328..1265393 + 66 NuclAT_24 - -
- (1265328) 1265328..1265393 + 66 NuclAT_24 - -
- (1265328) 1265328..1265393 + 66 NuclAT_24 - -
- (1265328) 1265328..1265393 + 66 NuclAT_27 - -
- (1265328) 1265328..1265393 + 66 NuclAT_27 - -
- (1265328) 1265328..1265393 + 66 NuclAT_27 - -
- (1265328) 1265328..1265393 + 66 NuclAT_27 - -
- (1265328) 1265328..1265393 + 66 NuclAT_30 - -
- (1265328) 1265328..1265393 + 66 NuclAT_30 - -
- (1265328) 1265328..1265393 + 66 NuclAT_30 - -
- (1265328) 1265328..1265393 + 66 NuclAT_30 - -
- (1265328) 1265328..1265393 + 66 NuclAT_33 - -
- (1265328) 1265328..1265393 + 66 NuclAT_33 - -
- (1265328) 1265328..1265393 + 66 NuclAT_33 - -
- (1265328) 1265328..1265393 + 66 NuclAT_33 - -
LOX89_RS06245 (1265706) 1265706..1265813 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1265862) 1265862..1265927 + 66 NuclAT_35 - -
- (1265862) 1265862..1265927 + 66 NuclAT_35 - -
- (1265862) 1265862..1265927 + 66 NuclAT_35 - -
- (1265862) 1265862..1265927 + 66 NuclAT_35 - -
- (1265862) 1265862..1265927 + 66 NuclAT_37 - -
- (1265862) 1265862..1265927 + 66 NuclAT_37 - -
- (1265862) 1265862..1265927 + 66 NuclAT_37 - -
- (1265862) 1265862..1265927 + 66 NuclAT_37 - -
- (1265862) 1265862..1265927 + 66 NuclAT_39 - -
- (1265862) 1265862..1265927 + 66 NuclAT_39 - -
- (1265862) 1265862..1265927 + 66 NuclAT_39 - -
- (1265862) 1265862..1265927 + 66 NuclAT_39 - -
- (1265862) 1265862..1265927 + 66 NuclAT_41 - -
- (1265862) 1265862..1265927 + 66 NuclAT_41 - -
- (1265862) 1265862..1265927 + 66 NuclAT_41 - -
- (1265862) 1265862..1265927 + 66 NuclAT_41 - -
- (1265862) 1265862..1265927 + 66 NuclAT_43 - -
- (1265862) 1265862..1265927 + 66 NuclAT_43 - -
- (1265862) 1265862..1265927 + 66 NuclAT_43 - -
- (1265862) 1265862..1265927 + 66 NuclAT_43 - -
- (1265862) 1265862..1265927 + 66 NuclAT_45 - -
- (1265862) 1265862..1265927 + 66 NuclAT_45 - -
- (1265862) 1265862..1265927 + 66 NuclAT_45 - -
- (1265862) 1265862..1265927 + 66 NuclAT_45 - -
- (1265861) 1265861..1265928 + 68 NuclAT_17 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_17 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_17 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_17 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_20 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_20 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_20 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_20 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_23 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_23 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_23 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_23 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_26 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_26 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_26 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_26 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_29 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_29 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_29 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_29 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_32 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_32 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_32 - Antitoxin
- (1265861) 1265861..1265928 + 68 NuclAT_32 - Antitoxin
LOX89_RS06250 (1266241) 1266241..1266348 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1266396) 1266396..1266463 + 68 NuclAT_16 - -
- (1266396) 1266396..1266463 + 68 NuclAT_16 - -
- (1266396) 1266396..1266463 + 68 NuclAT_16 - -
- (1266396) 1266396..1266463 + 68 NuclAT_16 - -
- (1266396) 1266396..1266463 + 68 NuclAT_19 - -
- (1266396) 1266396..1266463 + 68 NuclAT_19 - -
- (1266396) 1266396..1266463 + 68 NuclAT_19 - -
- (1266396) 1266396..1266463 + 68 NuclAT_19 - -
- (1266396) 1266396..1266463 + 68 NuclAT_22 - -
- (1266396) 1266396..1266463 + 68 NuclAT_22 - -
- (1266396) 1266396..1266463 + 68 NuclAT_22 - -
- (1266396) 1266396..1266463 + 68 NuclAT_22 - -
- (1266396) 1266396..1266463 + 68 NuclAT_25 - -
- (1266396) 1266396..1266463 + 68 NuclAT_25 - -
- (1266396) 1266396..1266463 + 68 NuclAT_25 - -
- (1266396) 1266396..1266463 + 68 NuclAT_25 - -
- (1266396) 1266396..1266463 + 68 NuclAT_28 - -
- (1266396) 1266396..1266463 + 68 NuclAT_28 - -
- (1266396) 1266396..1266463 + 68 NuclAT_28 - -
- (1266396) 1266396..1266463 + 68 NuclAT_28 - -
- (1266396) 1266396..1266463 + 68 NuclAT_31 - -
- (1266396) 1266396..1266463 + 68 NuclAT_31 - -
- (1266396) 1266396..1266463 + 68 NuclAT_31 - -
- (1266396) 1266396..1266463 + 68 NuclAT_31 - -
LOX89_RS06255 (1266752) 1266752..1267852 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
LOX89_RS06260 (1268122) 1268122..1268352 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LOX89_RS06265 (1268510) 1268510..1269205 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
LOX89_RS06270 (1269249) 1269249..1269602 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T224819 WP_000170963.1 NZ_CP087136:c1265813-1265706 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T224819 NZ_CP120557:4468929-4469306 [Escherichia coli]
ATGAAAACATTACCCGACACACACGTACGGGAGGCATCGCGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTGTC
CCGGTTGCTGGACCAGCATTACGGCCTTACGCTGAATGACACACCGTTCGCCGATGAACGTGTGATTGAGCAGCATATTG
AAGCTGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTTGAAAAATACGCACTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGTATTGATATTCTCCGGGCTCGCAGGGCAACCGGCCTGATGACCCGCGA
TAACTACAGAACGGTAAATAACATTACCCAGGGGAAGCATCCGGAGGCGAAACAATGA

Antitoxin


Download         Length: 68 bp

>AT224819 NZ_CP087136:1265861-1265928 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References