Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1265706..1265928 | Replicon | chromosome |
Accession | NZ_CP087136 | ||
Organism | Escherichia coli strain JW5503 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | LOX89_RS06245 | Protein ID | WP_000170963.1 |
Coordinates | 1265706..1265813 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1265861..1265928 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOX89_RS06215 (1261015) | 1261015..1262097 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
LOX89_RS06220 (1262097) | 1262097..1262930 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
LOX89_RS06225 (1262927) | 1262927..1263319 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
LOX89_RS06230 (1263323) | 1263323..1264132 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
LOX89_RS06235 (1264168) | 1264168..1265022 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
LOX89_RS06240 (1265171) | 1265171..1265278 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_34 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_34 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_34 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_34 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_36 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_36 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_36 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_36 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_38 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_38 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_38 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_38 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_40 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_40 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_40 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_40 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_42 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_42 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_42 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_42 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_44 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_44 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_44 | - | - |
- (1265326) | 1265326..1265392 | + | 67 | NuclAT_44 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_18 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_18 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_18 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_18 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_21 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_21 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_21 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_21 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_24 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_24 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_24 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_24 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_27 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_27 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_27 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_27 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_30 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_30 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_30 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_30 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_33 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_33 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_33 | - | - |
- (1265328) | 1265328..1265393 | + | 66 | NuclAT_33 | - | - |
LOX89_RS06245 (1265706) | 1265706..1265813 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_35 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_35 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_35 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_35 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_37 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_37 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_37 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_37 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_39 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_39 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_39 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_39 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_41 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_41 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_41 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_41 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_43 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_43 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_43 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_43 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_45 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_45 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_45 | - | - |
- (1265862) | 1265862..1265927 | + | 66 | NuclAT_45 | - | - |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1265861) | 1265861..1265928 | + | 68 | NuclAT_32 | - | Antitoxin |
LOX89_RS06250 (1266241) | 1266241..1266348 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_16 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_16 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_16 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_16 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_19 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_19 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_19 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_19 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_22 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_22 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_22 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_22 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_25 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_25 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_25 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_25 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_28 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_28 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_28 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_28 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_31 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_31 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_31 | - | - |
- (1266396) | 1266396..1266463 | + | 68 | NuclAT_31 | - | - |
LOX89_RS06255 (1266752) | 1266752..1267852 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
LOX89_RS06260 (1268122) | 1268122..1268352 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
LOX89_RS06265 (1268510) | 1268510..1269205 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
LOX89_RS06270 (1269249) | 1269249..1269602 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T224819 WP_000170963.1 NZ_CP087136:c1265813-1265706 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T224819 NZ_CP120557:4468929-4469306 [Escherichia coli]
ATGAAAACATTACCCGACACACACGTACGGGAGGCATCGCGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTGTC
CCGGTTGCTGGACCAGCATTACGGCCTTACGCTGAATGACACACCGTTCGCCGATGAACGTGTGATTGAGCAGCATATTG
AAGCTGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTTGAAAAATACGCACTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGTATTGATATTCTCCGGGCTCGCAGGGCAACCGGCCTGATGACCCGCGA
TAACTACAGAACGGTAAATAACATTACCCAGGGGAAGCATCCGGAGGCGAAACAATGA
ATGAAAACATTACCCGACACACACGTACGGGAGGCATCGCGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTGTC
CCGGTTGCTGGACCAGCATTACGGCCTTACGCTGAATGACACACCGTTCGCCGATGAACGTGTGATTGAGCAGCATATTG
AAGCTGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTTGAAAAATACGCACTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGTATTGATATTCTCCGGGCTCGCAGGGCAACCGGCCTGATGACCCGCGA
TAACTACAGAACGGTAAATAACATTACCCAGGGGAAGCATCCGGAGGCGAAACAATGA
Antitoxin
Download Length: 68 bp
>AT224819 NZ_CP087136:1265861-1265928 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|