Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1359940..1360161 Replicon chromosome
Accession NC_009801
Organism Escherichia coli E24377A

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag ECE24377A_RS08355 Protein ID WP_000170954.1
Coordinates 1359940..1360047 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1360095..1360161 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECE24377A_RS08330 1355784..1356866 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECE24377A_RS08335 1356866..1357699 + 834 WP_000456461.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECE24377A_RS08340 1357696..1358088 + 393 WP_000200392.1 invasion regulator SirB2 -
ECE24377A_RS08345 1358092..1358901 + 810 WP_001257044.1 invasion regulator SirB1 -
ECE24377A_RS08350 1358937..1359791 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECE24377A_RS08355 1359940..1360047 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1360095..1360161 + 67 NuclAT_14 - Antitoxin
- 1360095..1360161 + 67 NuclAT_14 - Antitoxin
- 1360095..1360161 + 67 NuclAT_14 - Antitoxin
- 1360095..1360161 + 67 NuclAT_14 - Antitoxin
- 1360095..1360161 + 67 NuclAT_16 - Antitoxin
- 1360095..1360161 + 67 NuclAT_16 - Antitoxin
- 1360095..1360161 + 67 NuclAT_16 - Antitoxin
- 1360095..1360161 + 67 NuclAT_16 - Antitoxin
- 1360095..1360161 + 67 NuclAT_18 - Antitoxin
- 1360095..1360161 + 67 NuclAT_18 - Antitoxin
- 1360095..1360161 + 67 NuclAT_18 - Antitoxin
- 1360095..1360161 + 67 NuclAT_18 - Antitoxin
- 1360095..1360161 + 67 NuclAT_20 - Antitoxin
- 1360095..1360161 + 67 NuclAT_20 - Antitoxin
- 1360095..1360161 + 67 NuclAT_20 - Antitoxin
- 1360095..1360161 + 67 NuclAT_20 - Antitoxin
- 1360095..1360161 + 67 NuclAT_22 - Antitoxin
- 1360095..1360161 + 67 NuclAT_22 - Antitoxin
- 1360095..1360161 + 67 NuclAT_22 - Antitoxin
- 1360095..1360161 + 67 NuclAT_22 - Antitoxin
- 1360095..1360161 + 67 NuclAT_24 - Antitoxin
- 1360095..1360161 + 67 NuclAT_24 - Antitoxin
- 1360095..1360161 + 67 NuclAT_24 - Antitoxin
- 1360095..1360161 + 67 NuclAT_24 - Antitoxin
- 1360097..1360160 + 64 NuclAT_27 - -
- 1360097..1360160 + 64 NuclAT_27 - -
- 1360097..1360160 + 64 NuclAT_27 - -
- 1360097..1360160 + 64 NuclAT_27 - -
- 1360097..1360160 + 64 NuclAT_29 - -
- 1360097..1360160 + 64 NuclAT_29 - -
- 1360097..1360160 + 64 NuclAT_29 - -
- 1360097..1360160 + 64 NuclAT_29 - -
- 1360097..1360160 + 64 NuclAT_31 - -
- 1360097..1360160 + 64 NuclAT_31 - -
- 1360097..1360160 + 64 NuclAT_31 - -
- 1360097..1360160 + 64 NuclAT_31 - -
- 1360097..1360160 + 64 NuclAT_33 - -
- 1360097..1360160 + 64 NuclAT_33 - -
- 1360097..1360160 + 64 NuclAT_33 - -
- 1360097..1360160 + 64 NuclAT_33 - -
- 1360097..1360160 + 64 NuclAT_35 - -
- 1360097..1360160 + 64 NuclAT_35 - -
- 1360097..1360160 + 64 NuclAT_35 - -
- 1360097..1360160 + 64 NuclAT_35 - -
- 1360097..1360160 + 64 NuclAT_37 - -
- 1360097..1360160 + 64 NuclAT_37 - -
- 1360097..1360160 + 64 NuclAT_37 - -
- 1360097..1360160 + 64 NuclAT_37 - -
ECE24377A_RS29975 1360475..1360582 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1360635..1360696 + 62 NuclAT_26 - -
- 1360635..1360696 + 62 NuclAT_26 - -
- 1360635..1360696 + 62 NuclAT_26 - -
- 1360635..1360696 + 62 NuclAT_26 - -
- 1360635..1360696 + 62 NuclAT_28 - -
- 1360635..1360696 + 62 NuclAT_28 - -
- 1360635..1360696 + 62 NuclAT_28 - -
- 1360635..1360696 + 62 NuclAT_28 - -
- 1360635..1360696 + 62 NuclAT_30 - -
- 1360635..1360696 + 62 NuclAT_30 - -
- 1360635..1360696 + 62 NuclAT_30 - -
- 1360635..1360696 + 62 NuclAT_30 - -
- 1360635..1360696 + 62 NuclAT_32 - -
- 1360635..1360696 + 62 NuclAT_32 - -
- 1360635..1360696 + 62 NuclAT_32 - -
- 1360635..1360696 + 62 NuclAT_32 - -
- 1360635..1360696 + 62 NuclAT_34 - -
- 1360635..1360696 + 62 NuclAT_34 - -
- 1360635..1360696 + 62 NuclAT_34 - -
- 1360635..1360696 + 62 NuclAT_34 - -
- 1360635..1360696 + 62 NuclAT_36 - -
- 1360635..1360696 + 62 NuclAT_36 - -
- 1360635..1360696 + 62 NuclAT_36 - -
- 1360635..1360696 + 62 NuclAT_36 - -
- 1360635..1360697 + 63 NuclAT_15 - -
- 1360635..1360697 + 63 NuclAT_15 - -
- 1360635..1360697 + 63 NuclAT_15 - -
- 1360635..1360697 + 63 NuclAT_15 - -
- 1360635..1360697 + 63 NuclAT_17 - -
- 1360635..1360697 + 63 NuclAT_17 - -
- 1360635..1360697 + 63 NuclAT_17 - -
- 1360635..1360697 + 63 NuclAT_17 - -
- 1360635..1360697 + 63 NuclAT_19 - -
- 1360635..1360697 + 63 NuclAT_19 - -
- 1360635..1360697 + 63 NuclAT_19 - -
- 1360635..1360697 + 63 NuclAT_19 - -
- 1360635..1360697 + 63 NuclAT_21 - -
- 1360635..1360697 + 63 NuclAT_21 - -
- 1360635..1360697 + 63 NuclAT_21 - -
- 1360635..1360697 + 63 NuclAT_21 - -
- 1360635..1360697 + 63 NuclAT_23 - -
- 1360635..1360697 + 63 NuclAT_23 - -
- 1360635..1360697 + 63 NuclAT_23 - -
- 1360635..1360697 + 63 NuclAT_23 - -
- 1360635..1360697 + 63 NuclAT_25 - -
- 1360635..1360697 + 63 NuclAT_25 - -
- 1360635..1360697 + 63 NuclAT_25 - -
- 1360635..1360697 + 63 NuclAT_25 - -
- 1360635..1360698 + 64 NuclAT_38 - -
- 1360635..1360698 + 64 NuclAT_38 - -
- 1360635..1360698 + 64 NuclAT_38 - -
- 1360635..1360698 + 64 NuclAT_38 - -
- 1360635..1360698 + 64 NuclAT_39 - -
- 1360635..1360698 + 64 NuclAT_39 - -
- 1360635..1360698 + 64 NuclAT_39 - -
- 1360635..1360698 + 64 NuclAT_39 - -
- 1360635..1360698 + 64 NuclAT_40 - -
- 1360635..1360698 + 64 NuclAT_40 - -
- 1360635..1360698 + 64 NuclAT_40 - -
- 1360635..1360698 + 64 NuclAT_40 - -
ECE24377A_RS08365 1360988..1362088 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
ECE24377A_RS08370 1362358..1362588 + 231 WP_001146442.1 putative cation transport regulator ChaB -
ECE24377A_RS08375 1362746..1363441 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
ECE24377A_RS08380 1363485..1363838 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T22445 WP_000170954.1 NC_009801:c1360047-1359940 [Escherichia coli O139:H28 str. E24377A]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T22445 NC_009801:c1360047-1359940 [Escherichia coli O139:H28 str. E24377A]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT22445 NC_009801:1360095-1360161 [Escherichia coli O139:H28 str. E24377A]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References