Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 16680..16938 | Replicon | chromosome |
Accession | NC_009801 | ||
Organism | Escherichia coli E24377A |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | ECE24377A_RS01720 | Protein ID | WP_000809168.1 |
Coordinates | 16680..16832 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 16881..16938 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECE24377A_RS01700 | 11921..12634 | - | 714 | WP_001102383.1 | acidic protein MsyB | - |
ECE24377A_RS01705 | 12660..13064 | - | 405 | WP_000843559.1 | DUF2541 family protein | - |
ECE24377A_RS01710 | 13441..15357 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
ECE24377A_RS01715 | 15446..16576 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
ECE24377A_RS01720 | 16680..16832 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 16881..16938 | + | 58 | - | - | Antitoxin |
ECE24377A_RS01725 | 17418..18584 | + | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
ECE24377A_RS01730 | 18650..19549 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
ECE24377A_RS01735 | 19588..20547 | - | 960 | WP_000871667.1 | hypothetical protein | - |
ECE24377A_RS01740 | 20560..21891 | - | 1332 | Protein_19 | fimbria/pilus outer membrane usher protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T22439 WP_000809168.1 NC_009801:c16832-16680 [Escherichia coli O139:H28 str. E24377A]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T22439 NC_009801:c16832-16680 [Escherichia coli O139:H28 str. E24377A]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT22439 NC_009801:16881-16938 [Escherichia coli O139:H28 str. E24377A]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|