Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 320144..320364 Replicon chromosome
Accession NZ_CP086662
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag LOE88_RS01600 Protein ID WP_000170954.1
Coordinates 320144..320251 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 320301..320364 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOE88_RS01575 (315988) 315988..317070 + 1083 WP_000804726.1 peptide chain release factor 1 -
LOE88_RS01580 (317070) 317070..317903 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
LOE88_RS01585 (317900) 317900..318292 + 393 WP_000200378.1 invasion regulator SirB2 -
LOE88_RS01590 (318296) 318296..319105 + 810 WP_001257044.1 invasion regulator SirB1 -
LOE88_RS01595 (319141) 319141..319995 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LOE88_RS01600 (320144) 320144..320251 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (320301) 320301..320364 + 64 NuclAT_45 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_45 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_45 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_45 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_48 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_48 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_48 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_48 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_51 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_51 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_51 - Antitoxin
- (320301) 320301..320364 + 64 NuclAT_51 - Antitoxin
LOE88_RS01605 (320679) 320679..320786 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (320839) 320839..320900 + 62 NuclAT_44 - -
- (320839) 320839..320900 + 62 NuclAT_44 - -
- (320839) 320839..320900 + 62 NuclAT_44 - -
- (320839) 320839..320900 + 62 NuclAT_44 - -
- (320839) 320839..320900 + 62 NuclAT_47 - -
- (320839) 320839..320900 + 62 NuclAT_47 - -
- (320839) 320839..320900 + 62 NuclAT_47 - -
- (320839) 320839..320900 + 62 NuclAT_47 - -
- (320839) 320839..320900 + 62 NuclAT_50 - -
- (320839) 320839..320900 + 62 NuclAT_50 - -
- (320839) 320839..320900 + 62 NuclAT_50 - -
- (320839) 320839..320900 + 62 NuclAT_50 - -
- (320839) 320839..320902 + 64 NuclAT_14 - -
- (320839) 320839..320902 + 64 NuclAT_14 - -
- (320839) 320839..320902 + 64 NuclAT_14 - -
- (320839) 320839..320902 + 64 NuclAT_14 - -
- (320839) 320839..320902 + 64 NuclAT_16 - -
- (320839) 320839..320902 + 64 NuclAT_16 - -
- (320839) 320839..320902 + 64 NuclAT_16 - -
- (320839) 320839..320902 + 64 NuclAT_16 - -
- (320839) 320839..320902 + 64 NuclAT_18 - -
- (320839) 320839..320902 + 64 NuclAT_18 - -
- (320839) 320839..320902 + 64 NuclAT_18 - -
- (320839) 320839..320902 + 64 NuclAT_18 - -
- (320839) 320839..320902 + 64 NuclAT_20 - -
- (320839) 320839..320902 + 64 NuclAT_20 - -
- (320839) 320839..320902 + 64 NuclAT_20 - -
- (320839) 320839..320902 + 64 NuclAT_20 - -
- (320839) 320839..320902 + 64 NuclAT_22 - -
- (320839) 320839..320902 + 64 NuclAT_22 - -
- (320839) 320839..320902 + 64 NuclAT_22 - -
- (320839) 320839..320902 + 64 NuclAT_22 - -
- (320839) 320839..320902 + 64 NuclAT_24 - -
- (320839) 320839..320902 + 64 NuclAT_24 - -
- (320839) 320839..320902 + 64 NuclAT_24 - -
- (320839) 320839..320902 + 64 NuclAT_24 - -
LOE88_RS01610 (321215) 321215..321322 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (321370) 321370..321435 + 66 NuclAT_43 - -
- (321370) 321370..321435 + 66 NuclAT_43 - -
- (321370) 321370..321435 + 66 NuclAT_43 - -
- (321370) 321370..321435 + 66 NuclAT_43 - -
- (321370) 321370..321435 + 66 NuclAT_46 - -
- (321370) 321370..321435 + 66 NuclAT_46 - -
- (321370) 321370..321435 + 66 NuclAT_46 - -
- (321370) 321370..321435 + 66 NuclAT_46 - -
- (321370) 321370..321435 + 66 NuclAT_49 - -
- (321370) 321370..321435 + 66 NuclAT_49 - -
- (321370) 321370..321435 + 66 NuclAT_49 - -
- (321370) 321370..321435 + 66 NuclAT_49 - -
- (321370) 321370..321437 + 68 NuclAT_13 - -
- (321370) 321370..321437 + 68 NuclAT_13 - -
- (321370) 321370..321437 + 68 NuclAT_13 - -
- (321370) 321370..321437 + 68 NuclAT_13 - -
- (321370) 321370..321437 + 68 NuclAT_15 - -
- (321370) 321370..321437 + 68 NuclAT_15 - -
- (321370) 321370..321437 + 68 NuclAT_15 - -
- (321370) 321370..321437 + 68 NuclAT_15 - -
- (321370) 321370..321437 + 68 NuclAT_17 - -
- (321370) 321370..321437 + 68 NuclAT_17 - -
- (321370) 321370..321437 + 68 NuclAT_17 - -
- (321370) 321370..321437 + 68 NuclAT_17 - -
- (321370) 321370..321437 + 68 NuclAT_19 - -
- (321370) 321370..321437 + 68 NuclAT_19 - -
- (321370) 321370..321437 + 68 NuclAT_19 - -
- (321370) 321370..321437 + 68 NuclAT_19 - -
- (321370) 321370..321437 + 68 NuclAT_21 - -
- (321370) 321370..321437 + 68 NuclAT_21 - -
- (321370) 321370..321437 + 68 NuclAT_21 - -
- (321370) 321370..321437 + 68 NuclAT_21 - -
- (321370) 321370..321437 + 68 NuclAT_23 - -
- (321370) 321370..321437 + 68 NuclAT_23 - -
- (321370) 321370..321437 + 68 NuclAT_23 - -
- (321370) 321370..321437 + 68 NuclAT_23 - -
LOE88_RS01615 (321727) 321727..322827 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LOE88_RS01620 (323097) 323097..323327 + 231 WP_001146442.1 putative cation transport regulator ChaB -
LOE88_RS01625 (323485) 323485..324180 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LOE88_RS01630 (324224) 324224..324577 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T224293 WP_000170954.1 NZ_CP086662:c320251-320144 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T224293 NZ_CP119981:263895-264311 [Salmonella enterica]
GTGAACAAGACTTATATGCTTGATACCTGTATCTGCTCGTTCATCATGCGTGAACAGCCAGAAGCCGTCCTGAAGCGTCT
GGAGCAGGCGGTGCTACGCGGCCACCGTATAGTGGTCTCGGCCATCACCTACTCTGAAATGCGCTTCGGGGCTACCGGCC
CAAAGGCCTCACCACGTCACGTCCAACTGGTCGATGAATTCTGCGCCCGCCTCGATGCCATCCTGCCCTGGGATCGCGCC
GCAGTAGACGCCACCACGAAGATTAAAGTGGCACTGCGGCTGGCCGGGACGCCGATCGGCCCGAACGACACGGCGATTGC
CGGGCACGCCATCGCCGCCGGGGCGATACTGGTAACGAATAATACAAGAGAATTTGAGCGAGTGCCTGACCTGGTGCTGG
AAGACTGGGTGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT224293 NZ_CP086662:320301-320364 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References