Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95725..95994 | Replicon | plasmid pRIVM_C039205_2 |
| Accession | NZ_CP086621 | ||
| Organism | Escherichia coli strain RIVM_C039205 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LN351_RS26015 | Protein ID | WP_001372321.1 |
| Coordinates | 95869..95994 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 95725..95790 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LN351_RS25975 | 90800..91048 | + | 249 | WP_071606928.1 | hypothetical protein | - |
| LN351_RS25980 | 91518..92045 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| LN351_RS25985 | 92101..92334 | + | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
| LN351_RS25990 | 92393..94351 | + | 1959 | WP_229327587.1 | ParB/RepB/Spo0J family partition protein | - |
| LN351_RS25995 | 94406..94840 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| LN351_RS26000 | 94837..95599 | + | 763 | Protein_122 | plasmid SOS inhibition protein A | - |
| LN351_RS26005 | 95568..95756 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 95568..95792 | + | 225 | NuclAT_0 | - | - |
| - | 95568..95792 | + | 225 | NuclAT_0 | - | - |
| - | 95568..95792 | + | 225 | NuclAT_0 | - | - |
| - | 95568..95792 | + | 225 | NuclAT_0 | - | - |
| - | 95725..95790 | - | 66 | - | - | Antitoxin |
| LN351_RS26010 | 95778..95927 | + | 150 | Protein_124 | plasmid maintenance protein Mok | - |
| LN351_RS26015 | 95869..95994 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LN351_RS26020 | 96214..96444 | + | 231 | WP_071587244.1 | hypothetical protein | - |
| LN351_RS26025 | 96442..96615 | - | 174 | Protein_127 | hypothetical protein | - |
| LN351_RS26030 | 96913..97200 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| LN351_RS26035 | 97321..98142 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| LN351_RS26040 | 98439..99086 | - | 648 | WP_124760006.1 | transglycosylase SLT domain-containing protein | - |
| LN351_RS26045 | 99372..99755 | + | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LN351_RS26050 | 99949..100635 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| LN351_RS26055 | 100729..100956 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 | - | 1..135854 | 135854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T224113 WP_001372321.1 NZ_CP086621:95869-95994 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T224113 NZ_CP119730:2830825-2830932 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT224113 NZ_CP086621:c95790-95725 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|