Detailed information of TA system TA224113

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95725..95994
• Replicon: plasmid pRIVM_C039205_2
• Accession: NZ_CP086621
• Organism: Escherichia coli strain RIVM_C039205

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LN351_RS26015
• Protein ID: WP_001372321.1
• Coordinates: 95869..95994 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	95725..95790 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LN351_RS25975	90800..91048	+	249	WP_071606928.1	hypothetical protein	-
LN351_RS25980	91518..92045	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
LN351_RS25985	92101..92334	+	234	WP_000006018.1	DUF905 domain-containing protein	-
LN351_RS25990	92393..94351	+	1959	WP_229327587.1	ParB/RepB/Spo0J family partition protein	-
LN351_RS25995	94406..94840	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
LN351_RS26000	94837..95599	+	763	Protein_122	plasmid SOS inhibition protein A	-
LN351_RS26005	95568..95756	-	189	WP_001299721.1	hypothetical protein	-
-	95568..95792	+	225	NuclAT_0	-	-
-	95568..95792	+	225	NuclAT_0	-	-
-	95568..95792	+	225	NuclAT_0	-	-
-	95568..95792	+	225	NuclAT_0	-	-
-	95725..95790	-	66	-	-	Antitoxin
LN351_RS26010	95778..95927	+	150	Protein_124	plasmid maintenance protein Mok	-
LN351_RS26015	95869..95994	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LN351_RS26020	96214..96444	+	231	WP_071587244.1	hypothetical protein	-
LN351_RS26025	96442..96615	-	174	Protein_127	hypothetical protein	-
LN351_RS26030	96913..97200	+	288	WP_000107537.1	hypothetical protein	-
LN351_RS26035	97321..98142	+	822	WP_001234469.1	DUF932 domain-containing protein	-
LN351_RS26040	98439..99086	-	648	WP_124760006.1	transglycosylase SLT domain-containing protein	-
LN351_RS26045	99372..99755	+	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LN351_RS26050	99949..100635	+	687	WP_000332487.1	PAS domain-containing protein	-
LN351_RS26055	100729..100956	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5	-	1..135854	135854

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T224113 WP_001372321.1 NZ_CP086621:95869-95994 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T224113 NZ_CP119730:2830825-2830932 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT224113 NZ_CP086621:c95790-95725 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin