Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 90874..91143 | Replicon | plasmid pRIVM_C039227_1 |
| Accession | NZ_CP086619 | ||
| Organism | Escherichia coli strain RIVM_C039227 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LN355_RS25820 | Protein ID | WP_001372321.1 |
| Coordinates | 91018..91143 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 90874..90939 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LN355_RS25780 | 85949..86197 | + | 249 | WP_071606928.1 | hypothetical protein | - |
| LN355_RS25785 | 86667..87194 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| LN355_RS25790 | 87250..87483 | + | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
| LN355_RS25795 | 87542..89500 | + | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
| LN355_RS25800 | 89555..89989 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| LN355_RS25805 | 89986..90748 | + | 763 | Protein_118 | plasmid SOS inhibition protein A | - |
| LN355_RS25810 | 90717..90905 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 90717..90941 | + | 225 | NuclAT_0 | - | - |
| - | 90717..90941 | + | 225 | NuclAT_0 | - | - |
| - | 90717..90941 | + | 225 | NuclAT_0 | - | - |
| - | 90717..90941 | + | 225 | NuclAT_0 | - | - |
| - | 90874..90939 | - | 66 | - | - | Antitoxin |
| LN355_RS25815 | 90927..91076 | + | 150 | Protein_120 | plasmid maintenance protein Mok | - |
| LN355_RS25820 | 91018..91143 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LN355_RS25825 | 91363..91593 | + | 231 | WP_071587244.1 | hypothetical protein | - |
| LN355_RS25830 | 91591..91764 | - | 174 | Protein_123 | hypothetical protein | - |
| LN355_RS25835 | 92062..92349 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| LN355_RS25840 | 92470..93291 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| LN355_RS25845 | 93588..94235 | - | 648 | WP_124760006.1 | transglycosylase SLT domain-containing protein | - |
| LN355_RS25850 | 94521..94904 | + | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LN355_RS25855 | 95098..95784 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| LN355_RS25860 | 95878..96105 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) | - | 1..126075 | 126075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T224082 WP_001372321.1 NZ_CP086619:91018-91143 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T224082 NZ_CP119726:1923263-1923514 [Escherichia coli]
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTTATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACAGAAAAGGAC
ATTATTGAGTGA
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTTATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACAGAAAAGGAC
ATTATTGAGTGA
Antitoxin
Download Length: 66 bp
>AT224082 NZ_CP086619:c90939-90874 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|