Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 96968..97237 | Replicon | plasmid pRIVM_C039629_1 |
Accession | NZ_CP086617 | ||
Organism | Escherichia coli strain RIVM_C039629 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | LN353_RS25495 | Protein ID | WP_001372321.1 |
Coordinates | 97112..97237 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 96968..97033 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LN353_RS25455 | 92043..92291 | + | 249 | WP_071606928.1 | hypothetical protein | - |
LN353_RS25460 | 92761..93288 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
LN353_RS25465 | 93344..93577 | + | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
LN353_RS25470 | 93636..95594 | + | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
LN353_RS25475 | 95649..96083 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
LN353_RS25480 | 96080..96842 | + | 763 | Protein_122 | plasmid SOS inhibition protein A | - |
LN353_RS25485 | 96811..96999 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 96811..97035 | + | 225 | NuclAT_0 | - | - |
- | 96811..97035 | + | 225 | NuclAT_0 | - | - |
- | 96811..97035 | + | 225 | NuclAT_0 | - | - |
- | 96811..97035 | + | 225 | NuclAT_0 | - | - |
- | 96968..97033 | - | 66 | - | - | Antitoxin |
LN353_RS25490 | 97021..97170 | + | 150 | Protein_124 | plasmid maintenance protein Mok | - |
LN353_RS25495 | 97112..97237 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
LN353_RS25500 | 97457..97687 | + | 231 | WP_071587244.1 | hypothetical protein | - |
LN353_RS25505 | 97685..97858 | - | 174 | Protein_127 | hypothetical protein | - |
LN353_RS25510 | 98156..98443 | + | 288 | WP_000107537.1 | hypothetical protein | - |
LN353_RS25515 | 98564..99385 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
LN353_RS25520 | 99682..100329 | - | 648 | WP_124760006.1 | transglycosylase SLT domain-containing protein | - |
LN353_RS25525 | 100615..100998 | + | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
LN353_RS25530 | 101192..101878 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
LN353_RS25535 | 101972..102199 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..138402 | 138402 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T224050 WP_001372321.1 NZ_CP086617:97112-97237 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T224050 NZ_CP119577:3541858-3542076 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTATACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTATACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 66 bp
>AT224050 NZ_CP086617:c97033-96968 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|