Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2949195..2949414 Replicon chromosome
Accession NZ_CP086604
Organism Escherichia fergusonii strain EF20JDJ4045

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag LNN29_RS14360 Protein ID WP_000170738.1
Coordinates 2949195..2949302 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2949351..2949414 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNN29_RS14330 (2944245) 2944245..2944433 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
LNN29_RS14335 (2944720) 2944720..2946279 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
LNN29_RS14340 (2946276) 2946276..2946467 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
LNN29_RS14345 (2946464) 2946464..2948143 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
LNN29_RS14350 (2948230) 2948230..2948337 - 108 WP_000170746.1 type I toxin-antitoxin system toxin Ldr family protein -
LNN29_RS14355 (2948713) 2948713..2948820 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2948869) 2948869..2948932 + 64 NuclAT_16 - -
- (2948869) 2948869..2948932 + 64 NuclAT_16 - -
- (2948869) 2948869..2948932 + 64 NuclAT_16 - -
- (2948869) 2948869..2948932 + 64 NuclAT_16 - -
- (2948869) 2948869..2948932 + 64 NuclAT_18 - -
- (2948869) 2948869..2948932 + 64 NuclAT_18 - -
- (2948869) 2948869..2948932 + 64 NuclAT_18 - -
- (2948869) 2948869..2948932 + 64 NuclAT_18 - -
- (2948869) 2948869..2948932 + 64 NuclAT_20 - -
- (2948869) 2948869..2948932 + 64 NuclAT_20 - -
- (2948869) 2948869..2948932 + 64 NuclAT_20 - -
- (2948869) 2948869..2948932 + 64 NuclAT_20 - -
- (2948869) 2948869..2948932 + 64 NuclAT_22 - -
- (2948869) 2948869..2948932 + 64 NuclAT_22 - -
- (2948869) 2948869..2948932 + 64 NuclAT_22 - -
- (2948869) 2948869..2948932 + 64 NuclAT_22 - -
- (2948869) 2948869..2948934 + 66 NuclAT_11 - -
- (2948869) 2948869..2948934 + 66 NuclAT_11 - -
- (2948869) 2948869..2948934 + 66 NuclAT_11 - -
- (2948869) 2948869..2948934 + 66 NuclAT_11 - -
- (2948869) 2948869..2948934 + 66 NuclAT_13 - -
- (2948869) 2948869..2948934 + 66 NuclAT_13 - -
- (2948869) 2948869..2948934 + 66 NuclAT_13 - -
- (2948869) 2948869..2948934 + 66 NuclAT_13 - -
LNN29_RS14360 (2949195) 2949195..2949302 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2949351) 2949351..2949414 + 64 NuclAT_15 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_15 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_15 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_15 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_17 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_17 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_17 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_17 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_19 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_19 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_19 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_19 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_21 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_21 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_21 - Antitoxin
- (2949351) 2949351..2949414 + 64 NuclAT_21 - Antitoxin
- (2949351) 2949351..2949416 + 66 NuclAT_10 - -
- (2949351) 2949351..2949416 + 66 NuclAT_10 - -
- (2949351) 2949351..2949416 + 66 NuclAT_10 - -
- (2949351) 2949351..2949416 + 66 NuclAT_10 - -
- (2949351) 2949351..2949416 + 66 NuclAT_12 - -
- (2949351) 2949351..2949416 + 66 NuclAT_12 - -
- (2949351) 2949351..2949416 + 66 NuclAT_12 - -
- (2949351) 2949351..2949416 + 66 NuclAT_12 - -
LNN29_RS14370 (2949738) 2949738..2950934 + 1197 WP_104920204.1 methionine gamma-lyase -
LNN29_RS14375 (2951184) 2951184..2952482 + 1299 WP_104920205.1 amino acid permease -
LNN29_RS14380 (2952498) 2952498..2953214 - 717 Protein_2819 sigma 54-interacting transcriptional regulator -
LNN29_RS14385 (2953270) 2953270..2953967 + 698 WP_095033700.1 IS1-like element IS1B family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T223992 WP_000170738.1 NZ_CP086604:c2949302-2949195 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T223992 NZ_CP119536:613824-614183 [Agrobacterium fabrum]
ATGGTCCGCAACCAGATCCCCAAGCGCGGCGACGTTTATCTGGTTGATCTAAACCCTGTCGTAGGCAGCGAAATCAAGGA
CGAACATCGCTGTGTCGTCATCACGCCCAGAGAAATTAACGCGGTCGGACTCTGTCTCGTCGTCCCGGTGACCACCGGCG
GCATGTTTACGCGCAAGGCAGGGCTTGCCGTAAATATATCCGGCCACAAGACAACGGGCGTCGCTTTGTGCAATCAGGTG
AGAAGCATGGATATCGTCGCCCGGGTTGCCCAGAAGAAAGCGAAATATATCGAAACCCTCGATGATGCGACGATCGATGA
AATCGCCGGGCGCGTCATCAGCATGATCGATCCAGCTTGA

Antitoxin


Download         Length: 64 bp

>AT223992 NZ_CP086604:2949351-2949414 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References