Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 2948713..2948932 | Replicon | chromosome |
| Accession | NZ_CP086604 | ||
| Organism | Escherichia fergusonii strain EF20JDJ4045 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | LNN29_RS14355 | Protein ID | WP_000170738.1 |
| Coordinates | 2948713..2948820 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 2948869..2948932 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNN29_RS14330 (2944245) | 2944245..2944433 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| LNN29_RS14335 (2944720) | 2944720..2946279 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| LNN29_RS14340 (2946276) | 2946276..2946467 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| LNN29_RS14345 (2946464) | 2946464..2948143 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| LNN29_RS14350 (2948230) | 2948230..2948337 | - | 108 | WP_000170746.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| LNN29_RS14355 (2948713) | 2948713..2948820 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_16 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_16 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_16 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_16 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_18 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_18 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_18 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_18 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_20 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_20 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_20 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_20 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2948869) | 2948869..2948932 | + | 64 | NuclAT_22 | - | Antitoxin |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_11 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_11 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_11 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_11 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_13 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_13 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_13 | - | - |
| - (2948869) | 2948869..2948934 | + | 66 | NuclAT_13 | - | - |
| LNN29_RS14360 (2949195) | 2949195..2949302 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_15 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_15 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_15 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_15 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_17 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_17 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_17 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_17 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_19 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_19 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_19 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_19 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_21 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_21 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_21 | - | - |
| - (2949351) | 2949351..2949414 | + | 64 | NuclAT_21 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_10 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_10 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_10 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_10 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_12 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_12 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_12 | - | - |
| - (2949351) | 2949351..2949416 | + | 66 | NuclAT_12 | - | - |
| LNN29_RS14370 (2949738) | 2949738..2950934 | + | 1197 | WP_104920204.1 | methionine gamma-lyase | - |
| LNN29_RS14375 (2951184) | 2951184..2952482 | + | 1299 | WP_104920205.1 | amino acid permease | - |
| LNN29_RS14380 (2952498) | 2952498..2953214 | - | 717 | Protein_2819 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T223990 WP_000170738.1 NZ_CP086604:c2948820-2948713 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T223990 NZ_CP119536:c355118-354849 [Agrobacterium fabrum]
GTGATCTGGACAATTGAATATCACACGCTTGTGCAGAAAGAGATGCGCAAAATAAATCCGGAAGTGCGCCGGCGCATCCG
CAGTTTTCTCCATGAAAGGCTGGCCGCACTGGACGACCCGCGCCAGATCGGCGCTACACTGCAAGGTTCCGAACTCGGAA
ATTTCTGGCGTTACCGGGTGGGCGATTACCGCATCATCTGCGATATACAGGACCAAAAGCTGGTCGTTCTGGTGGTCGAA
ATCGGCCATCGCCGTGAAATTTACCGTTAG
GTGATCTGGACAATTGAATATCACACGCTTGTGCAGAAAGAGATGCGCAAAATAAATCCGGAAGTGCGCCGGCGCATCCG
CAGTTTTCTCCATGAAAGGCTGGCCGCACTGGACGACCCGCGCCAGATCGGCGCTACACTGCAAGGTTCCGAACTCGGAA
ATTTCTGGCGTTACCGGGTGGGCGATTACCGCATCATCTGCGATATACAGGACCAAAAGCTGGTCGTTCTGGTGGTCGAA
ATCGGCCATCGCCGTGAAATTTACCGTTAG
Antitoxin
Download Length: 64 bp
>AT223990 NZ_CP086604:2948869-2948932 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACATGCGGGGGTTTT
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACATGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|