Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2449098..2449282 | Replicon | chromosome |
Accession | NZ_CP086574 | ||
Organism | Staphylococcus argenteus strain RIVM_M046968 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | LK342_RS11835 | Protein ID | WP_047527328.1 |
Coordinates | 2449175..2449282 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2449098..2449158 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LK342_RS11825 (LK342_11825) | 2444952..2446685 | - | 1734 | WP_047431349.1 | ABC transporter ATP-binding protein | - |
LK342_RS11830 (LK342_11830) | 2446710..2448473 | - | 1764 | WP_047527326.1 | ABC transporter ATP-binding protein | - |
- | 2449098..2449158 | + | 61 | - | - | Antitoxin |
LK342_RS11835 (LK342_11835) | 2449175..2449282 | - | 108 | WP_047527328.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
LK342_RS11840 (LK342_11840) | 2449417..2449803 | - | 387 | WP_047527330.1 | flippase GtxA | - |
LK342_RS11845 (LK342_11845) | 2450070..2451212 | + | 1143 | WP_047527332.1 | glycerate kinase | - |
LK342_RS11850 (LK342_11850) | 2451271..2451930 | + | 660 | WP_000831306.1 | membrane protein | - |
LK342_RS11855 (LK342_11855) | 2452115..2453326 | + | 1212 | WP_047527334.1 | multidrug effflux MFS transporter | - |
LK342_RS11860 (LK342_11860) | 2453442..2453921 | - | 480 | WP_047527336.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T223944 WP_047527328.1 NZ_CP086574:c2449282-2449175 [Staphylococcus argenteus]
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T223944 NZ_CP119408:1914499-1914601 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT223944 NZ_CP086574:2449098-2449158 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|