Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2371438..2371622 | Replicon | chromosome |
Accession | NZ_CP086572 | ||
Organism | Staphylococcus argenteus strain RIVM_M036020 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | LK336_RS11320 | Protein ID | WP_000482653.1 |
Coordinates | 2371438..2371545 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2371562..2371622 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LK336_RS11295 | 2366799..2367278 | + | 480 | WP_031787190.1 | GyrI-like domain-containing protein | - |
LK336_RS11300 | 2367394..2368605 | - | 1212 | WP_031787189.1 | multidrug effflux MFS transporter | - |
LK336_RS11305 | 2368790..2369449 | - | 660 | WP_000831306.1 | membrane protein | - |
LK336_RS11310 | 2369508..2370650 | - | 1143 | WP_031787188.1 | glycerate kinase | - |
LK336_RS11315 | 2370918..2371304 | + | 387 | WP_000779346.1 | flippase GtxA | - |
LK336_RS11320 | 2371438..2371545 | + | 108 | WP_000482653.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2371562..2371622 | - | 61 | - | - | Antitoxin |
LK336_RS11325 | 2372249..2374012 | + | 1764 | WP_031787187.1 | ABC transporter ATP-binding protein | - |
LK336_RS11330 | 2374037..2375770 | + | 1734 | WP_031787186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4025.81 Da Isoelectric Point: 11.0582
>T223933 WP_000482653.1 NZ_CP086572:2371438-2371545 [Staphylococcus argenteus]
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T223933 NZ_CP119404:2640276-2640383 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT223933 NZ_CP086572:c2371622-2371562 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|