Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2564123..2564307 | Replicon | chromosome |
| Accession | NC_009782 | ||
| Organism | Staphylococcus aureus subsp. aureus Mu3 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | SAHV_RS13120 | Protein ID | WP_000482652.1 |
| Coordinates | 2564200..2564307 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2564123..2564183 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAHV_RS13095 | 2559578..2559745 | - | 168 | Protein_2492 | hypothetical protein | - |
| SAHV_RS13105 | 2559976..2561709 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
| SAHV_RS13110 | 2561734..2563497 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2564123..2564183 | + | 61 | - | - | Antitoxin |
| SAHV_RS13120 | 2564200..2564307 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAHV_RS13125 | 2564441..2564827 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| SAHV_RS13130 | 2565095..2566237 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| SAHV_RS13135 | 2566297..2566956 | + | 660 | WP_000831298.1 | membrane protein | - |
| SAHV_RS13140 | 2567138..2568349 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| SAHV_RS13145 | 2568472..2568945 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T22388 WP_000482652.1 NC_009782:c2564307-2564200 [Staphylococcus aureus subsp. aureus Mu3]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T22388 NC_009782:c2564307-2564200 [Staphylococcus aureus subsp. aureus Mu3]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT22388 NC_009782:2564123-2564183 [Staphylococcus aureus subsp. aureus Mu3]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|