Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2277790..2278006 | Replicon | chromosome |
Accession | NC_009782 | ||
Organism | Staphylococcus aureus subsp. aureus Mu3 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAHV_RS11605 | Protein ID | WP_001802298.1 |
Coordinates | 2277902..2278006 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2277790..2277845 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAHV_RS11585 | 2273996..2274661 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
SAHV_RS11590 | 2274813..2275133 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAHV_RS11595 | 2275135..2276112 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
SAHV_RS11600 | 2276378..2277469 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2277790..2277845 | + | 56 | - | - | Antitoxin |
SAHV_RS11605 | 2277902..2278006 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAHV_RS15570 | 2278523..2278693 | + | 171 | WP_001792292.1 | transposase | - |
SAHV_RS15220 | 2278686..2278844 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAHV_RS11610 | 2279502..2280359 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
SAHV_RS11615 | 2280427..2281209 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T22385 WP_001802298.1 NC_009782:c2278006-2277902 [Staphylococcus aureus subsp. aureus Mu3]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T22385 NC_009782:c2278006-2277902 [Staphylococcus aureus subsp. aureus Mu3]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT22385 NC_009782:2277790-2277845 [Staphylococcus aureus subsp. aureus Mu3]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|