Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 59148..59402 Replicon plasmid pEc-050-T5-MAC_2
Accession NZ_CP086502
Organism Escherichia coli strain Ec-050-T5-MAC

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag LNN49_RS24295 Protein ID WP_001312851.1
Coordinates 59148..59297 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 59341..59402 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNN49_RS24265 (54395) 54395..55306 - 912 WP_000440183.1 carbamate kinase -
LNN49_RS24270 (55317) 55317..56537 - 1221 WP_000410951.1 arginine deiminase -
LNN49_RS24275 (57244) 57244..57858 + 615 Protein_67 VENN motif pre-toxin domain-containing protein -
LNN49_RS24280 (57858) 57858..58304 - 447 Protein_68 plasmid replication initiator RepA -
LNN49_RS24285 (58297) 58297..58371 - 75 WP_032336874.1 RepA leader peptide Tap -
LNN49_RS24290 (58607) 58607..58864 - 258 WP_000083833.1 replication regulatory protein RepA -
LNN49_RS24295 (59148) 59148..59297 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (59341) 59341..59402 + 62 NuclAT_0 - Antitoxin
- (59341) 59341..59402 + 62 NuclAT_0 - Antitoxin
- (59341) 59341..59402 + 62 NuclAT_0 - Antitoxin
- (59341) 59341..59402 + 62 NuclAT_0 - Antitoxin
LNN49_RS24300 (59541) 59541..59723 - 183 WP_000968309.1 hypothetical protein -
LNN49_RS24305 (59824) 59824..60440 + 617 Protein_73 IS1-like element IS1A family transposase -
LNN49_RS24310 (60478) 60478..62049 - 1572 WP_023149734.1 IS66-like element ISCro1 family transposase -
LNN49_RS24315 (62069) 62069..62416 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
LNN49_RS24320 (62416) 62416..63093 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
LNN49_RS24325 (63148) 63148..63237 + 90 Protein_77 IS1 family transposase -
LNN49_RS24330 (63538) 63538..63750 - 213 WP_005012601.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aac(3)-IIa / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 / tet(A) / sitABCD iutA / iucD / iucC / iucB / iucA 1..99465 99465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T223607 WP_001312851.1 NZ_CP086502:c59297-59148 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T223607 NZ_CP119013:2044459-2044561 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 62 bp

>AT223607 NZ_CP086502:59341-59402 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References