Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59148..59402 | Replicon | plasmid pEc-050-T5-MAC_2 |
| Accession | NZ_CP086502 | ||
| Organism | Escherichia coli strain Ec-050-T5-MAC | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LNN49_RS24295 | Protein ID | WP_001312851.1 |
| Coordinates | 59148..59297 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59341..59402 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNN49_RS24265 (54395) | 54395..55306 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| LNN49_RS24270 (55317) | 55317..56537 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| LNN49_RS24275 (57244) | 57244..57858 | + | 615 | Protein_67 | VENN motif pre-toxin domain-containing protein | - |
| LNN49_RS24280 (57858) | 57858..58304 | - | 447 | Protein_68 | plasmid replication initiator RepA | - |
| LNN49_RS24285 (58297) | 58297..58371 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| LNN49_RS24290 (58607) | 58607..58864 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| LNN49_RS24295 (59148) | 59148..59297 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (59341) | 59341..59402 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (59341) | 59341..59402 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (59341) | 59341..59402 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (59341) | 59341..59402 | + | 62 | NuclAT_0 | - | Antitoxin |
| LNN49_RS24300 (59541) | 59541..59723 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| LNN49_RS24305 (59824) | 59824..60440 | + | 617 | Protein_73 | IS1-like element IS1A family transposase | - |
| LNN49_RS24310 (60478) | 60478..62049 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| LNN49_RS24315 (62069) | 62069..62416 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LNN49_RS24320 (62416) | 62416..63093 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| LNN49_RS24325 (63148) | 63148..63237 | + | 90 | Protein_77 | IS1 family transposase | - |
| LNN49_RS24330 (63538) | 63538..63750 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / aac(3)-IIa / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 / tet(A) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..99465 | 99465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T223607 WP_001312851.1 NZ_CP086502:c59297-59148 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T223607 NZ_CP119013:2044459-2044561 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 62 bp
>AT223607 NZ_CP086502:59341-59402 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|