Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2351433..2351653 Replicon chromosome
Accession NZ_CP086391
Organism Escherichia coli strain 1585m1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag LM401_RS13690 Protein ID WP_000170965.1
Coordinates 2351546..2351653 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2351433..2351499 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LM401_RS13665 2346712..2348106 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
LM401_RS13670 2348291..2348644 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
LM401_RS13675 2348688..2349383 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LM401_RS13680 2349541..2349771 - 231 WP_001146442.1 putative cation transport regulator ChaB -
LM401_RS13685 2350041..2351141 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2351433..2351499 - 67 - - Antitoxin
LM401_RS13690 2351546..2351653 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2351966..2352029 - 64 NuclAT_35 - -
- 2351966..2352029 - 64 NuclAT_35 - -
- 2351966..2352029 - 64 NuclAT_35 - -
- 2351966..2352029 - 64 NuclAT_35 - -
- 2351966..2352029 - 64 NuclAT_38 - -
- 2351966..2352029 - 64 NuclAT_38 - -
- 2351966..2352029 - 64 NuclAT_38 - -
- 2351966..2352029 - 64 NuclAT_38 - -
- 2351966..2352029 - 64 NuclAT_41 - -
- 2351966..2352029 - 64 NuclAT_41 - -
- 2351966..2352029 - 64 NuclAT_41 - -
- 2351966..2352029 - 64 NuclAT_41 - -
- 2351966..2352029 - 64 NuclAT_44 - -
- 2351966..2352029 - 64 NuclAT_44 - -
- 2351966..2352029 - 64 NuclAT_44 - -
- 2351966..2352029 - 64 NuclAT_44 - -
- 2351966..2352029 - 64 NuclAT_47 - -
- 2351966..2352029 - 64 NuclAT_47 - -
- 2351966..2352029 - 64 NuclAT_47 - -
- 2351966..2352029 - 64 NuclAT_47 - -
- 2351966..2352029 - 64 NuclAT_50 - -
- 2351966..2352029 - 64 NuclAT_50 - -
- 2351966..2352029 - 64 NuclAT_50 - -
- 2351966..2352029 - 64 NuclAT_50 - -
- 2351967..2352029 - 63 NuclAT_52 - -
- 2351967..2352029 - 63 NuclAT_52 - -
- 2351967..2352029 - 63 NuclAT_52 - -
- 2351967..2352029 - 63 NuclAT_52 - -
- 2351967..2352029 - 63 NuclAT_55 - -
- 2351967..2352029 - 63 NuclAT_55 - -
- 2351967..2352029 - 63 NuclAT_55 - -
- 2351967..2352029 - 63 NuclAT_55 - -
- 2351968..2352029 - 62 NuclAT_17 - -
- 2351968..2352029 - 62 NuclAT_17 - -
- 2351968..2352029 - 62 NuclAT_17 - -
- 2351968..2352029 - 62 NuclAT_17 - -
- 2351968..2352029 - 62 NuclAT_20 - -
- 2351968..2352029 - 62 NuclAT_20 - -
- 2351968..2352029 - 62 NuclAT_20 - -
- 2351968..2352029 - 62 NuclAT_20 - -
- 2351968..2352029 - 62 NuclAT_23 - -
- 2351968..2352029 - 62 NuclAT_23 - -
- 2351968..2352029 - 62 NuclAT_23 - -
- 2351968..2352029 - 62 NuclAT_23 - -
- 2351968..2352029 - 62 NuclAT_26 - -
- 2351968..2352029 - 62 NuclAT_26 - -
- 2351968..2352029 - 62 NuclAT_26 - -
- 2351968..2352029 - 62 NuclAT_26 - -
- 2351968..2352029 - 62 NuclAT_29 - -
- 2351968..2352029 - 62 NuclAT_29 - -
- 2351968..2352029 - 62 NuclAT_29 - -
- 2351968..2352029 - 62 NuclAT_29 - -
- 2351968..2352029 - 62 NuclAT_32 - -
- 2351968..2352029 - 62 NuclAT_32 - -
- 2351968..2352029 - 62 NuclAT_32 - -
- 2351968..2352029 - 62 NuclAT_32 - -
LM401_RS13695 2352082..2352189 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2352502..2352567 - 66 NuclAT_34 - -
- 2352502..2352567 - 66 NuclAT_34 - -
- 2352502..2352567 - 66 NuclAT_34 - -
- 2352502..2352567 - 66 NuclAT_34 - -
- 2352502..2352567 - 66 NuclAT_37 - -
- 2352502..2352567 - 66 NuclAT_37 - -
- 2352502..2352567 - 66 NuclAT_37 - -
- 2352502..2352567 - 66 NuclAT_37 - -
- 2352502..2352567 - 66 NuclAT_40 - -
- 2352502..2352567 - 66 NuclAT_40 - -
- 2352502..2352567 - 66 NuclAT_40 - -
- 2352502..2352567 - 66 NuclAT_40 - -
- 2352502..2352567 - 66 NuclAT_43 - -
- 2352502..2352567 - 66 NuclAT_43 - -
- 2352502..2352567 - 66 NuclAT_43 - -
- 2352502..2352567 - 66 NuclAT_43 - -
- 2352502..2352567 - 66 NuclAT_46 - -
- 2352502..2352567 - 66 NuclAT_46 - -
- 2352502..2352567 - 66 NuclAT_46 - -
- 2352502..2352567 - 66 NuclAT_46 - -
- 2352502..2352567 - 66 NuclAT_49 - -
- 2352502..2352567 - 66 NuclAT_49 - -
- 2352502..2352567 - 66 NuclAT_49 - -
- 2352502..2352567 - 66 NuclAT_49 - -
- 2352503..2352569 - 67 NuclAT_51 - -
- 2352503..2352569 - 67 NuclAT_51 - -
- 2352503..2352569 - 67 NuclAT_51 - -
- 2352503..2352569 - 67 NuclAT_51 - -
- 2352503..2352569 - 67 NuclAT_54 - -
- 2352503..2352569 - 67 NuclAT_54 - -
- 2352503..2352569 - 67 NuclAT_54 - -
- 2352503..2352569 - 67 NuclAT_54 - -
- 2352504..2352567 - 64 NuclAT_16 - -
- 2352504..2352567 - 64 NuclAT_16 - -
- 2352504..2352567 - 64 NuclAT_16 - -
- 2352504..2352567 - 64 NuclAT_16 - -
- 2352504..2352567 - 64 NuclAT_19 - -
- 2352504..2352567 - 64 NuclAT_19 - -
- 2352504..2352567 - 64 NuclAT_19 - -
- 2352504..2352567 - 64 NuclAT_19 - -
- 2352504..2352567 - 64 NuclAT_22 - -
- 2352504..2352567 - 64 NuclAT_22 - -
- 2352504..2352567 - 64 NuclAT_22 - -
- 2352504..2352567 - 64 NuclAT_22 - -
- 2352504..2352567 - 64 NuclAT_25 - -
- 2352504..2352567 - 64 NuclAT_25 - -
- 2352504..2352567 - 64 NuclAT_25 - -
- 2352504..2352567 - 64 NuclAT_25 - -
- 2352504..2352567 - 64 NuclAT_28 - -
- 2352504..2352567 - 64 NuclAT_28 - -
- 2352504..2352567 - 64 NuclAT_28 - -
- 2352504..2352567 - 64 NuclAT_28 - -
- 2352504..2352567 - 64 NuclAT_31 - -
- 2352504..2352567 - 64 NuclAT_31 - -
- 2352504..2352567 - 64 NuclAT_31 - -
- 2352504..2352567 - 64 NuclAT_31 - -
LM401_RS13700 2352617..2352724 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
LM401_RS13705 2352873..2353727 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LM401_RS13710 2353763..2354572 - 810 WP_001257044.1 invasion regulator SirB1 -
LM401_RS13715 2354576..2354968 - 393 WP_000200392.1 invasion regulator SirB2 -
LM401_RS13720 2354965..2355798 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T223169 WP_000170965.1 NZ_CP086391:2351546-2351653 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T223169 NZ_CP118542:c4086514-4086230 [Salmonella sp. CVCC 1806]
ATGACTTATGAACTGGAATTCGACCCGAGGGCCTTAAAAGAGTGGCATAAGCTGGGCGATACGGTGCAGGCTCAGCTTAA
GAAAAAGTTGGCTGATGTGCTATTGAACCCCAGAATCGACTCTGCCCGTTTAAACGATCCTCCTGACTGCTATAAAATTA
AGCTTAAATCGTCCGGTTATCGCTTGGTGTACCAGGTTCGGGATGACGTTGTGATTGTGTTTGTTGTCGCGGTCGGTAAG
CGAGAACATTCAGCCGTCTATCACGATGCAAACAAACGGCTTTAG

Antitoxin


Download         Length: 67 bp

>AT223169 NZ_CP086391:c2351499-2351433 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References