Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1010462..1010683 | Replicon | chromosome |
Accession | NZ_CP086220 | ||
Organism | Escherichia coli strain 779 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | LMB17_RS04925 | Protein ID | WP_000170954.1 |
Coordinates | 1010462..1010569 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1010617..1010683 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LMB17_RS04900 (1006306) | 1006306..1007388 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
LMB17_RS04905 (1007388) | 1007388..1008221 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
LMB17_RS04910 (1008218) | 1008218..1008610 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
LMB17_RS04915 (1008614) | 1008614..1009423 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
LMB17_RS04920 (1009459) | 1009459..1010313 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
LMB17_RS04925 (1010462) | 1010462..1010569 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_40 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_40 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_40 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_40 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_42 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_42 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_42 | - | - |
- (1010619) | 1010619..1010682 | + | 64 | NuclAT_42 | - | - |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_27 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_29 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_29 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_29 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_29 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_31 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_31 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_31 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_31 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_33 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_33 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_33 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_33 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_35 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_35 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_35 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_35 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_37 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_37 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_37 | - | Antitoxin |
- (1010617) | 1010617..1010683 | + | 67 | NuclAT_37 | - | Antitoxin |
LMB17_RS04930 (1010997) | 1010997..1011104 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_39 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_39 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_39 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_39 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_41 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_41 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_41 | - | - |
- (1011157) | 1011157..1011218 | + | 62 | NuclAT_41 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_28 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_28 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_28 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_28 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_30 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_30 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_30 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_30 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_32 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_32 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_32 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_32 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_34 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_34 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_34 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_34 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_36 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_36 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_36 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_36 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_38 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_38 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_38 | - | - |
- (1011157) | 1011157..1011219 | + | 63 | NuclAT_38 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_16 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_16 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_16 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_16 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_18 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_18 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_18 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_18 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_20 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_20 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_20 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_20 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_22 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_22 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_22 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_22 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_24 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_24 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_24 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_24 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_26 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_26 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_26 | - | - |
- (1011157) | 1011157..1011220 | + | 64 | NuclAT_26 | - | - |
LMB17_RS04935 (1011533) | 1011533..1011640 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_15 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_15 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_15 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_15 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_17 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_17 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_17 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_17 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_19 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_19 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_19 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_19 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_21 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_21 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_21 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_21 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_23 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_23 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_23 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_23 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_25 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_25 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_25 | - | - |
- (1011688) | 1011688..1011755 | + | 68 | NuclAT_25 | - | - |
LMB17_RS04940 (1012045) | 1012045..1013145 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
LMB17_RS04945 (1013415) | 1013415..1013645 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
LMB17_RS04950 (1013803) | 1013803..1014498 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
LMB17_RS04955 (1014542) | 1014542..1014895 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T222781 WP_000170954.1 NZ_CP086220:c1010569-1010462 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T222781 NZ_CP118138:812772-812954 [Pseudomonas chlororaphis]
GTGAACAGTCGGTATTTGATCGGCCAAATCGTCGCAGACGGTTGGTATCTGGTCAGGGTCAGAGGCAGTCACCACCCTTT
CAGGCCCCCCAGTAAACCGGGGCTGGTGACAGTTCCACATCCCAAAAAGGACCTGCTGAGAAAAACCGCCATCAGCATTC
TGAAACAGGCGCTGCTCATGTGA
GTGAACAGTCGGTATTTGATCGGCCAAATCGTCGCAGACGGTTGGTATCTGGTCAGGGTCAGAGGCAGTCACCACCCTTT
CAGGCCCCCCAGTAAACCGGGGCTGGTGACAGTTCCACATCCCAAAAAGGACCTGCTGAGAAAAACCGCCATCAGCATTC
TGAAACAGGCGCTGCTCATGTGA
Antitoxin
Download Length: 67 bp
>AT222781 NZ_CP086220:1010617-1010683 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|