Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1256656..1256876 Replicon chromosome
Accession NZ_CP085842
Organism Escherichia coli strain B95. delta A

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag LJ838_RS06245 Protein ID WP_000170951.1
Coordinates 1256656..1256763 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1256813..1256876 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJ838_RS06215 (1251869) 1251869..1253125 + 1257 WP_001295619.1 glutamyl-tRNA reductase -
LJ838_RS06220 (1253210) 1253210..1253584 + 375 WP_063842998.1 phleomycin/bleomycin binding protein Ble-Sh -
LJ838_RS06225 (1253584) 1253584..1254417 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
LJ838_RS06230 (1254414) 1254414..1254806 + 393 WP_000200373.1 invasion regulator SirB2 -
LJ838_RS06235 (1254810) 1254810..1255619 + 810 WP_001257044.1 invasion regulator SirB1 -
LJ838_RS06240 (1255655) 1255655..1256509 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LJ838_RS06245 (1256656) 1256656..1256763 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1256813) 1256813..1256876 + 64 NuclAT_32 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_32 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_32 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_32 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_35 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_35 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_35 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_35 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_38 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_38 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_38 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_38 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_41 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_41 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_41 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_41 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_47 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_47 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_47 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_47 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_50 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_50 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_50 - Antitoxin
- (1256813) 1256813..1256876 + 64 NuclAT_50 - Antitoxin
LJ838_RS06250 (1257191) 1257191..1257298 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1257346) 1257346..1257411 + 66 NuclAT_30 - -
- (1257346) 1257346..1257411 + 66 NuclAT_30 - -
- (1257346) 1257346..1257411 + 66 NuclAT_30 - -
- (1257346) 1257346..1257411 + 66 NuclAT_30 - -
- (1257346) 1257346..1257411 + 66 NuclAT_33 - -
- (1257346) 1257346..1257411 + 66 NuclAT_33 - -
- (1257346) 1257346..1257411 + 66 NuclAT_33 - -
- (1257346) 1257346..1257411 + 66 NuclAT_33 - -
- (1257346) 1257346..1257411 + 66 NuclAT_36 - -
- (1257346) 1257346..1257411 + 66 NuclAT_36 - -
- (1257346) 1257346..1257411 + 66 NuclAT_36 - -
- (1257346) 1257346..1257411 + 66 NuclAT_36 - -
- (1257346) 1257346..1257411 + 66 NuclAT_39 - -
- (1257346) 1257346..1257411 + 66 NuclAT_39 - -
- (1257346) 1257346..1257411 + 66 NuclAT_39 - -
- (1257346) 1257346..1257411 + 66 NuclAT_39 - -
- (1257346) 1257346..1257411 + 66 NuclAT_45 - -
- (1257346) 1257346..1257411 + 66 NuclAT_45 - -
- (1257346) 1257346..1257411 + 66 NuclAT_45 - -
- (1257346) 1257346..1257411 + 66 NuclAT_45 - -
- (1257346) 1257346..1257411 + 66 NuclAT_48 - -
- (1257346) 1257346..1257411 + 66 NuclAT_48 - -
- (1257346) 1257346..1257411 + 66 NuclAT_48 - -
- (1257346) 1257346..1257411 + 66 NuclAT_48 - -
- (1257346) 1257346..1257413 + 68 NuclAT_16 - -
- (1257346) 1257346..1257413 + 68 NuclAT_16 - -
- (1257346) 1257346..1257413 + 68 NuclAT_16 - -
- (1257346) 1257346..1257413 + 68 NuclAT_16 - -
- (1257346) 1257346..1257413 + 68 NuclAT_18 - -
- (1257346) 1257346..1257413 + 68 NuclAT_18 - -
- (1257346) 1257346..1257413 + 68 NuclAT_18 - -
- (1257346) 1257346..1257413 + 68 NuclAT_18 - -
- (1257346) 1257346..1257413 + 68 NuclAT_20 - -
- (1257346) 1257346..1257413 + 68 NuclAT_20 - -
- (1257346) 1257346..1257413 + 68 NuclAT_20 - -
- (1257346) 1257346..1257413 + 68 NuclAT_20 - -
- (1257346) 1257346..1257413 + 68 NuclAT_22 - -
- (1257346) 1257346..1257413 + 68 NuclAT_22 - -
- (1257346) 1257346..1257413 + 68 NuclAT_22 - -
- (1257346) 1257346..1257413 + 68 NuclAT_22 - -
- (1257346) 1257346..1257413 + 68 NuclAT_24 - -
- (1257346) 1257346..1257413 + 68 NuclAT_24 - -
- (1257346) 1257346..1257413 + 68 NuclAT_24 - -
- (1257346) 1257346..1257413 + 68 NuclAT_24 - -
- (1257346) 1257346..1257413 + 68 NuclAT_26 - -
- (1257346) 1257346..1257413 + 68 NuclAT_26 - -
- (1257346) 1257346..1257413 + 68 NuclAT_26 - -
- (1257346) 1257346..1257413 + 68 NuclAT_26 - -
LJ838_RS06255 (1257726) 1257726..1257833 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1257881) 1257881..1257946 + 66 NuclAT_31 - -
- (1257881) 1257881..1257946 + 66 NuclAT_31 - -
- (1257881) 1257881..1257946 + 66 NuclAT_31 - -
- (1257881) 1257881..1257946 + 66 NuclAT_31 - -
- (1257881) 1257881..1257946 + 66 NuclAT_34 - -
- (1257881) 1257881..1257946 + 66 NuclAT_34 - -
- (1257881) 1257881..1257946 + 66 NuclAT_34 - -
- (1257881) 1257881..1257946 + 66 NuclAT_34 - -
- (1257881) 1257881..1257946 + 66 NuclAT_37 - -
- (1257881) 1257881..1257946 + 66 NuclAT_37 - -
- (1257881) 1257881..1257946 + 66 NuclAT_37 - -
- (1257881) 1257881..1257946 + 66 NuclAT_37 - -
- (1257881) 1257881..1257946 + 66 NuclAT_40 - -
- (1257881) 1257881..1257946 + 66 NuclAT_40 - -
- (1257881) 1257881..1257946 + 66 NuclAT_40 - -
- (1257881) 1257881..1257946 + 66 NuclAT_40 - -
- (1257881) 1257881..1257946 + 66 NuclAT_46 - -
- (1257881) 1257881..1257946 + 66 NuclAT_46 - -
- (1257881) 1257881..1257946 + 66 NuclAT_46 - -
- (1257881) 1257881..1257946 + 66 NuclAT_46 - -
- (1257881) 1257881..1257946 + 66 NuclAT_49 - -
- (1257881) 1257881..1257946 + 66 NuclAT_49 - -
- (1257881) 1257881..1257946 + 66 NuclAT_49 - -
- (1257881) 1257881..1257946 + 66 NuclAT_49 - -
- (1257881) 1257881..1257948 + 68 NuclAT_15 - -
- (1257881) 1257881..1257948 + 68 NuclAT_15 - -
- (1257881) 1257881..1257948 + 68 NuclAT_15 - -
- (1257881) 1257881..1257948 + 68 NuclAT_15 - -
- (1257881) 1257881..1257948 + 68 NuclAT_17 - -
- (1257881) 1257881..1257948 + 68 NuclAT_17 - -
- (1257881) 1257881..1257948 + 68 NuclAT_17 - -
- (1257881) 1257881..1257948 + 68 NuclAT_17 - -
- (1257881) 1257881..1257948 + 68 NuclAT_19 - -
- (1257881) 1257881..1257948 + 68 NuclAT_19 - -
- (1257881) 1257881..1257948 + 68 NuclAT_19 - -
- (1257881) 1257881..1257948 + 68 NuclAT_19 - -
- (1257881) 1257881..1257948 + 68 NuclAT_21 - -
- (1257881) 1257881..1257948 + 68 NuclAT_21 - -
- (1257881) 1257881..1257948 + 68 NuclAT_21 - -
- (1257881) 1257881..1257948 + 68 NuclAT_21 - -
- (1257881) 1257881..1257948 + 68 NuclAT_23 - -
- (1257881) 1257881..1257948 + 68 NuclAT_23 - -
- (1257881) 1257881..1257948 + 68 NuclAT_23 - -
- (1257881) 1257881..1257948 + 68 NuclAT_23 - -
- (1257881) 1257881..1257948 + 68 NuclAT_25 - -
- (1257881) 1257881..1257948 + 68 NuclAT_25 - -
- (1257881) 1257881..1257948 + 68 NuclAT_25 - -
- (1257881) 1257881..1257948 + 68 NuclAT_25 - -
LJ838_RS06260 (1258238) 1258238..1259338 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LJ838_RS06265 (1259608) 1259608..1259838 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LJ838_RS06270 (1259996) 1259996..1260691 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
LJ838_RS06275 (1260735) 1260735..1261088 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T222139 WP_000170951.1 NZ_CP085842:c1256763-1256656 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T222139 NZ_CP117709:c2346133-2345810 [Streptomyces sp. MMBL 11-1]
GTGGACCTGGAGCCCGCGCGGGGGAGCGAAGCCAACAAGGTGCGCCCTGCAGTGATCGTTTCCAACAACGCCGCCAACCG
GTCGGTCGAGCTGACCGGCAGGGGCGTCGTCGCCGTGGTGCCCCTGACCTCGAACACCTCAAGAGTCCTCAGCTTTCAGG
TGCTTCTCGCAGCGAAAGAGAGCCAACTTCCGCAGAACTCCAAGGTCCAGTGCGAACAGATCCGGGCCGTCTTCCCCGAT
CGGGTACTGAAGCGAATCGGTGAGGTCCCCCGCCAGCGCATGGCCGAGATCGACGCGGCCCTCCGCCGCCATCTCGCGCT
CTGA

Antitoxin


Download         Length: 64 bp

>AT222139 NZ_CP085842:1256813-1256876 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References