Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1256656..1256876 | Replicon | chromosome |
| Accession | NZ_CP085842 | ||
| Organism | Escherichia coli strain B95. delta A | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | LJ838_RS06245 | Protein ID | WP_000170951.1 |
| Coordinates | 1256656..1256763 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1256813..1256876 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ838_RS06215 (1251869) | 1251869..1253125 | + | 1257 | WP_001295619.1 | glutamyl-tRNA reductase | - |
| LJ838_RS06220 (1253210) | 1253210..1253584 | + | 375 | WP_063842998.1 | phleomycin/bleomycin binding protein Ble-Sh | - |
| LJ838_RS06225 (1253584) | 1253584..1254417 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| LJ838_RS06230 (1254414) | 1254414..1254806 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| LJ838_RS06235 (1254810) | 1254810..1255619 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| LJ838_RS06240 (1255655) | 1255655..1256509 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| LJ838_RS06245 (1256656) | 1256656..1256763 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_50 | - | Antitoxin |
| - (1256813) | 1256813..1256876 | + | 64 | NuclAT_50 | - | Antitoxin |
| LJ838_RS06250 (1257191) | 1257191..1257298 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_30 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_30 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_30 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_30 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_33 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_33 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_33 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_33 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_36 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_36 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_36 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_36 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_39 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_39 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_39 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_39 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_45 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_45 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_45 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_45 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_48 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_48 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_48 | - | - |
| - (1257346) | 1257346..1257411 | + | 66 | NuclAT_48 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_16 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_16 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_16 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_16 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_18 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_18 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_18 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_18 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_20 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_20 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_20 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_20 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_22 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_22 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_22 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_22 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_24 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_24 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_24 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_24 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_26 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_26 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_26 | - | - |
| - (1257346) | 1257346..1257413 | + | 68 | NuclAT_26 | - | - |
| LJ838_RS06255 (1257726) | 1257726..1257833 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_31 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_31 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_31 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_31 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_34 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_34 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_34 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_34 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_37 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_37 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_37 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_37 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_40 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_40 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_40 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_40 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_46 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_46 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_46 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_46 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_49 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_49 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_49 | - | - |
| - (1257881) | 1257881..1257946 | + | 66 | NuclAT_49 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_15 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_15 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_15 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_15 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_17 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_17 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_17 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_17 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_19 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_19 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_19 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_19 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_21 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_21 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_21 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_21 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_23 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_23 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_23 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_23 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_25 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_25 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_25 | - | - |
| - (1257881) | 1257881..1257948 | + | 68 | NuclAT_25 | - | - |
| LJ838_RS06260 (1258238) | 1258238..1259338 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| LJ838_RS06265 (1259608) | 1259608..1259838 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| LJ838_RS06270 (1259996) | 1259996..1260691 | + | 696 | WP_012775986.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| LJ838_RS06275 (1260735) | 1260735..1261088 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T222139 WP_000170951.1 NZ_CP085842:c1256763-1256656 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T222139 NZ_CP117709:c2346133-2345810 [Streptomyces sp. MMBL 11-1]
GTGGACCTGGAGCCCGCGCGGGGGAGCGAAGCCAACAAGGTGCGCCCTGCAGTGATCGTTTCCAACAACGCCGCCAACCG
GTCGGTCGAGCTGACCGGCAGGGGCGTCGTCGCCGTGGTGCCCCTGACCTCGAACACCTCAAGAGTCCTCAGCTTTCAGG
TGCTTCTCGCAGCGAAAGAGAGCCAACTTCCGCAGAACTCCAAGGTCCAGTGCGAACAGATCCGGGCCGTCTTCCCCGAT
CGGGTACTGAAGCGAATCGGTGAGGTCCCCCGCCAGCGCATGGCCGAGATCGACGCGGCCCTCCGCCGCCATCTCGCGCT
CTGA
GTGGACCTGGAGCCCGCGCGGGGGAGCGAAGCCAACAAGGTGCGCCCTGCAGTGATCGTTTCCAACAACGCCGCCAACCG
GTCGGTCGAGCTGACCGGCAGGGGCGTCGTCGCCGTGGTGCCCCTGACCTCGAACACCTCAAGAGTCCTCAGCTTTCAGG
TGCTTCTCGCAGCGAAAGAGAGCCAACTTCCGCAGAACTCCAAGGTCCAGTGCGAACAGATCCGGGCCGTCTTCCCCGAT
CGGGTACTGAAGCGAATCGGTGAGGTCCCCCGCCAGCGCATGGCCGAGATCGACGCGGCCCTCCGCCGCCATCTCGCGCT
CTGA
Antitoxin
Download Length: 64 bp
>AT222139 NZ_CP085842:1256813-1256876 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|