Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2011868..2012093 Replicon chromosome
Accession NZ_CP085816
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain Slowpoke

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag LJF68_RS09935 Protein ID WP_000813254.1
Coordinates 2011868..2012023 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2012035..2012093 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJF68_RS09900 2006975..2007256 - 282 WP_000445513.1 phage holin family protein -
LJF68_RS09905 2007246..2007434 - 189 WP_001688615.1 putative holin -
LJF68_RS09910 2007428..2007751 - 324 Protein_1935 tellurite/colicin resistance protein -
LJF68_RS09915 2009922..2010458 - 537 WP_000640113.1 DUF1133 family protein -
LJF68_RS09920 2010455..2010745 - 291 WP_000774470.1 DUF1364 domain-containing protein -
LJF68_RS09925 2010745..2011344 - 600 WP_000940751.1 DUF1367 family protein -
LJF68_RS09930 2011407..2011577 - 171 WP_000734094.1 hypothetical protein -
LJF68_RS09935 2011868..2012023 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2012035..2012093 + 59 - - Antitoxin
LJF68_RS09940 2012450..2013382 + 933 WP_000556390.1 hypothetical protein -
LJF68_RS09945 2013379..2013933 + 555 WP_001033796.1 hypothetical protein -
LJF68_RS09950 2014095..2014424 - 330 WP_001676916.1 DUF977 family protein -
LJF68_RS23015 2014468..2014515 - 48 Protein_1944 hypothetical protein -
LJF68_RS09960 2014697..2015164 + 468 WP_001227859.1 helix-turn-helix domain-containing protein -
LJF68_RS09965 2015549..2015704 + 156 WP_085981757.1 DUF1391 family protein -
LJF68_RS09970 2015812..2016333 - 522 WP_000004762.1 super-infection exclusion protein B -
LJF68_RS09975 2016771..2016992 + 222 WP_000560208.1 cell division protein FtsZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2006433..2016333 9900


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T221881 WP_000813254.1 NZ_CP085816:c2012023-2011868 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

>T221881 NZ_CP117615:2132936-2133038 [Escherichia albertii]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAAAACA
GGAATCGTTTTCGGTCTCTTTTT

Antitoxin


Download         Length: 59 bp

>AT221881 NZ_CP085816:2012035-2012093 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References