Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1278287..1278512 | Replicon | chromosome |
Accession | NZ_CP085815 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain Slowbro |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | LJF37_RS06320 | Protein ID | WP_000813254.1 |
Coordinates | 1278287..1278442 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1278454..1278512 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LJF37_RS06285 | 1273394..1273675 | - | 282 | WP_000445513.1 | phage holin family protein | - |
LJF37_RS06290 | 1273665..1273853 | - | 189 | WP_001688615.1 | putative holin | - |
LJF37_RS06295 | 1273847..1274170 | - | 324 | Protein_1235 | tellurite/colicin resistance protein | - |
LJF37_RS06300 | 1276341..1276877 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
LJF37_RS06305 | 1276874..1277164 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
LJF37_RS06310 | 1277164..1277763 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
LJF37_RS06315 | 1277826..1277996 | - | 171 | WP_000734094.1 | hypothetical protein | - |
LJF37_RS06320 | 1278287..1278442 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 1278454..1278512 | + | 59 | - | - | Antitoxin |
LJF37_RS06325 | 1278869..1279801 | + | 933 | WP_000556390.1 | hypothetical protein | - |
LJF37_RS06330 | 1279798..1280352 | + | 555 | WP_001033796.1 | hypothetical protein | - |
LJF37_RS06335 | 1280514..1280843 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
LJF37_RS23010 | 1280887..1280934 | - | 48 | Protein_1244 | hypothetical protein | - |
LJF37_RS06345 | 1281116..1281583 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
LJF37_RS06350 | 1281968..1282123 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
LJF37_RS06355 | 1282231..1282752 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
LJF37_RS06360 | 1283190..1283411 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1272852..1284723 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T221853 WP_000813254.1 NZ_CP085815:c1278442-1278287 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T221853 NZ_CP117607:c65389-65240 [Escherichia albertii]
ATGACGAAATATACCCTAATTGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGAGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTAATTGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGAGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT221853 NZ_CP085815:1278454-1278512 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|