Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2011756..2011981 Replicon chromosome
Accession NZ_CP085813
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain Minun

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag LJF39_RS09925 Protein ID WP_000813254.1
Coordinates 2011756..2011911 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2011923..2011981 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJF39_RS09890 2006863..2007144 - 282 WP_000445513.1 phage holin family protein -
LJF39_RS09895 2007134..2007322 - 189 WP_001688615.1 putative holin -
LJF39_RS09900 2007316..2007639 - 324 Protein_1933 tellurite/colicin resistance protein -
LJF39_RS09905 2009810..2010346 - 537 WP_000640113.1 DUF1133 family protein -
LJF39_RS09910 2010343..2010633 - 291 WP_000774470.1 DUF1364 domain-containing protein -
LJF39_RS09915 2010633..2011232 - 600 WP_000940751.1 DUF1367 family protein -
LJF39_RS09920 2011295..2011465 - 171 WP_000734094.1 hypothetical protein -
LJF39_RS09925 2011756..2011911 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2011923..2011981 + 59 - - Antitoxin
LJF39_RS09930 2012338..2013270 + 933 WP_000556390.1 hypothetical protein -
LJF39_RS09935 2013267..2013821 + 555 WP_001033796.1 hypothetical protein -
LJF39_RS09940 2013983..2014312 - 330 WP_001676916.1 DUF977 family protein -
LJF39_RS23020 2014356..2014403 - 48 Protein_1942 hypothetical protein -
LJF39_RS09950 2014585..2015052 + 468 WP_001227859.1 helix-turn-helix domain-containing protein -
LJF39_RS09955 2015437..2015592 + 156 WP_085981757.1 DUF1391 family protein -
LJF39_RS09960 2015700..2016221 - 522 WP_000004762.1 super-infection exclusion protein B -
LJF39_RS09965 2016659..2016880 + 222 WP_000560208.1 cell division protein FtsZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2006321..2016221 9900


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T221805 WP_000813254.1 NZ_CP085813:c2011911-2011756 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

>T221805 NZ_CP117595:2075085-2075188 [Escherichia albertii]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAAAAC
AGGAATCGTTTTCGGTCTCTTTTT

Antitoxin


Download         Length: 59 bp

>AT221805 NZ_CP085813:2011923-2011981 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References