Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3406859..3407084 | Replicon | chromosome |
Accession | NZ_CP085795 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain Frogadier |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | LJF59_RS16440 | Protein ID | WP_000813254.1 |
Coordinates | 3406929..3407084 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3406859..3406917 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LJF59_RS16400 | 3401960..3402181 | - | 222 | WP_000560208.1 | cell division protein FtsZ | - |
LJF59_RS16405 | 3402619..3403140 | + | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
LJF59_RS16410 | 3403248..3403403 | - | 156 | WP_085981757.1 | DUF1391 family protein | - |
LJF59_RS16415 | 3403788..3404255 | - | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
LJF59_RS22770 | 3404437..3404484 | + | 48 | Protein_3180 | hypothetical protein | - |
LJF59_RS16425 | 3404528..3404857 | + | 330 | WP_001676916.1 | DUF977 family protein | - |
LJF59_RS16430 | 3405019..3405573 | - | 555 | WP_001033796.1 | hypothetical protein | - |
LJF59_RS16435 | 3405570..3406502 | - | 933 | WP_000556390.1 | hypothetical protein | - |
- | 3406859..3406917 | - | 59 | - | - | Antitoxin |
LJF59_RS16440 | 3406929..3407084 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
LJF59_RS16445 | 3407375..3407545 | + | 171 | WP_000734094.1 | hypothetical protein | - |
LJF59_RS16450 | 3407608..3408207 | + | 600 | WP_000940751.1 | DUF1367 family protein | - |
LJF59_RS16455 | 3408207..3408497 | + | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
LJF59_RS16460 | 3408494..3409030 | + | 537 | WP_000640113.1 | DUF1133 family protein | - |
LJF59_RS16465 | 3411201..3411524 | + | 324 | Protein_3189 | tellurite/colicin resistance protein | - |
LJF59_RS16470 | 3411518..3411706 | + | 189 | WP_001688615.1 | putative holin | - |
LJF59_RS16475 | 3411696..3411977 | + | 282 | WP_000445513.1 | phage holin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3400648..3412519 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T221406 WP_000813254.1 NZ_CP085795:3406929-3407084 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T221406 NZ_CP117388:3685370-3685627 [Salmonella enterica subsp. enterica serovar Uganda]
ATGAATGCCTCCGGCGTCAGCGTCCGCCATATCAACAGCGAAACCTGCATGTCCGCCTGTTACTCACAAATCCCCAGCCA
GCACCTTAAGGGTGACTGGCAGGAAGAAGCGGGATTTGAGACCGGGCGCAGCATCACCGTGAAGATTTCACAGGAGTGTA
TTGTGCTGATGGCGGACAGTAACGAGGAACAGAAGCTGCGCGAACAGCTTTACAAGGCTGAACAGGTGGTTAAGGGGATG
CGGGACGTGATTGTTTAG
ATGAATGCCTCCGGCGTCAGCGTCCGCCATATCAACAGCGAAACCTGCATGTCCGCCTGTTACTCACAAATCCCCAGCCA
GCACCTTAAGGGTGACTGGCAGGAAGAAGCGGGATTTGAGACCGGGCGCAGCATCACCGTGAAGATTTCACAGGAGTGTA
TTGTGCTGATGGCGGACAGTAACGAGGAACAGAAGCTGCGCGAACAGCTTTACAAGGCTGAACAGGTGGTTAAGGGGATG
CGGGACGTGATTGTTTAG
Antitoxin
Download Length: 59 bp
>AT221406 NZ_CP085795:c3406917-3406859 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|