Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3406646..3406871 | Replicon | chromosome |
| Accession | NZ_CP085794 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain Greninja | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | LJF60_RS16435 | Protein ID | WP_000813254.1 |
| Coordinates | 3406716..3406871 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3406646..3406704 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJF60_RS16395 | 3401747..3401968 | - | 222 | WP_000560208.1 | cell division protein FtsZ | - |
| LJF60_RS16400 | 3402406..3402927 | + | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
| LJF60_RS16405 | 3403035..3403190 | - | 156 | WP_085981757.1 | DUF1391 family protein | - |
| LJF60_RS16410 | 3403575..3404042 | - | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
| LJF60_RS22765 | 3404224..3404271 | + | 48 | Protein_3180 | hypothetical protein | - |
| LJF60_RS16420 | 3404315..3404644 | + | 330 | WP_001676916.1 | DUF977 family protein | - |
| LJF60_RS16425 | 3404806..3405360 | - | 555 | WP_001033796.1 | hypothetical protein | - |
| LJF60_RS16430 | 3405357..3406289 | - | 933 | WP_000556390.1 | hypothetical protein | - |
| - | 3406646..3406704 | - | 59 | - | - | Antitoxin |
| LJF60_RS16435 | 3406716..3406871 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| LJF60_RS16440 | 3407162..3407332 | + | 171 | WP_000734094.1 | hypothetical protein | - |
| LJF60_RS16445 | 3407395..3407994 | + | 600 | WP_000940751.1 | DUF1367 family protein | - |
| LJF60_RS16450 | 3407994..3408284 | + | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
| LJF60_RS16455 | 3408281..3408817 | + | 537 | WP_000640113.1 | DUF1133 family protein | - |
| LJF60_RS16460 | 3410988..3411311 | + | 324 | Protein_3189 | tellurite/colicin resistance protein | - |
| LJF60_RS16465 | 3411305..3411493 | + | 189 | WP_001688615.1 | putative holin | - |
| LJF60_RS16470 | 3411483..3411764 | + | 282 | WP_000445513.1 | phage holin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3400435..3412306 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T221380 WP_000813254.1 NZ_CP085794:3406716-3406871 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T221380 NZ_CP085794:3406716-3406871 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT221380 NZ_CP085794:c3406704-3406646 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|