Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2306167..2306383 | Replicon | chromosome |
Accession | NC_009487 | ||
Organism | Staphylococcus aureus subsp. aureus JH9 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAURJH9_RS11845 | Protein ID | WP_001802298.1 |
Coordinates | 2306279..2306383 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2306167..2306222 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAURJH9_RS11825 | 2302373..2303038 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
SAURJH9_RS11830 | 2303190..2303510 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAURJH9_RS11835 | 2303512..2304489 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
SAURJH9_RS11840 | 2304755..2305846 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2306167..2306222 | + | 56 | - | - | Antitoxin |
SAURJH9_RS11845 | 2306279..2306383 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAURJH9_RS15615 | 2307063..2307221 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAURJH9_RS11850 | 2307879..2308736 | - | 858 | WP_000370923.1 | Cof-type HAD-IIB family hydrolase | - |
SAURJH9_RS11855 | 2308804..2309586 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T22123 WP_001802298.1 NC_009487:c2306383-2306279 [Staphylococcus aureus subsp. aureus JH9]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T22123 NC_009487:c2306383-2306279 [Staphylococcus aureus subsp. aureus JH9]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT22123 NC_009487:2306167-2306222 [Staphylococcus aureus subsp. aureus JH9]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|