Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2134516..2134815 | Replicon | chromosome |
| Accession | NC_009487 | ||
| Organism | Staphylococcus aureus subsp. aureus JH9 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAURJH9_RS15570 | Protein ID | WP_011447039.1 |
| Coordinates | 2134639..2134815 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2134516..2134571 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAURJH9_RS10845 | 2129847..2130107 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAURJH9_RS10850 | 2130160..2130510 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAURJH9_RS10855 | 2131195..2131644 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAURJH9_RS15890 | 2131739..2132074 | - | 336 | Protein_2062 | SH3 domain-containing protein | - |
| SAURJH9_RS10865 | 2132724..2133215 | - | 492 | WP_000919350.1 | staphylokinase | - |
| SAURJH9_RS10870 | 2133406..2134161 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAURJH9_RS10875 | 2134173..2134427 | - | 255 | WP_000611512.1 | phage holin | - |
| SAURJH9_RS10880 | 2134479..2134586 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2134508..2134647 | + | 140 | NuclAT_0 | - | - |
| - | 2134508..2134647 | + | 140 | NuclAT_0 | - | - |
| - | 2134508..2134647 | + | 140 | NuclAT_0 | - | - |
| - | 2134508..2134647 | + | 140 | NuclAT_0 | - | - |
| - | 2134516..2134571 | + | 56 | - | - | Antitoxin |
| SAURJH9_RS15570 | 2134639..2134815 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAURJH9_RS10890 | 2134965..2135261 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SAURJH9_RS10895 | 2135319..2135606 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| SAURJH9_RS10900 | 2135653..2135805 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| SAURJH9_RS10905 | 2135795..2139580 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2130160..2183678 | 53518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T22119 WP_011447039.1 NC_009487:c2134815-2134639 [Staphylococcus aureus subsp. aureus JH9]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T22119 NC_009487:c2134815-2134639 [Staphylococcus aureus subsp. aureus JH9]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT22119 NC_009487:2134516-2134571 [Staphylococcus aureus subsp. aureus JH9]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|