Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 51746..52010 | Replicon | plasmid unnamed1 |
Accession | NZ_CP085077 | ||
Organism | Escherichia coli strain P21_SE1_04.20 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | LH372_RS25660 | Protein ID | WP_001387489.1 |
Coordinates | 51746..51898 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 51950..52010 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LH372_RS25620 (46838) | 46838..47371 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
LH372_RS25625 (47465) | 47465..48610 | - | 1146 | WP_039023136.1 | extended-spectrum class C beta-lactamase CMY-42 | - |
LH372_RS25635 (49815) | 49815..49913 | + | 99 | Protein_55 | ethanolamine utilization protein EutE | - |
LH372_RS25640 (49985) | 49985..50194 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
LH372_RS25645 (50586) | 50586..50762 | + | 177 | WP_001054897.1 | hypothetical protein | - |
LH372_RS25650 (50827) | 50827..51123 | - | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
LH372_RS25655 (51423) | 51423..51674 | + | 252 | WP_001291964.1 | hypothetical protein | - |
LH372_RS25660 (51746) | 51746..51898 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- (51950) | 51950..52010 | + | 61 | NuclAT_0 | - | Antitoxin |
- (51950) | 51950..52010 | + | 61 | NuclAT_0 | - | Antitoxin |
- (51950) | 51950..52010 | + | 61 | NuclAT_0 | - | Antitoxin |
- (51950) | 51950..52010 | + | 61 | NuclAT_0 | - | Antitoxin |
LH372_RS25665 (52219) | 52219..52593 | + | 375 | WP_223349261.1 | hypothetical protein | - |
LH372_RS25670 (52746) | 52746..53903 | + | 1158 | Protein_62 | IS1380-like element ISEcp1 family transposase | - |
LH372_RS25675 (53959) | 53959..54656 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
LH372_RS25680 (54667) | 54667..54975 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
LH372_RS25685 (55417) | 55417..55704 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
LH372_RS25690 (55742) | 55742..55900 | - | 159 | Protein_66 | ash family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCMY-42 | - | 1..56811 | 56811 | |
- | inside | IScluster/Tn | blaCMY-42 | - | 47465..54234 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T220388 WP_001387489.1 NZ_CP085077:c51898-51746 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T220388 NZ_CP117013:3022272-3022379 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAACACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAACACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT220388 NZ_CP085077:51950-52010 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|