Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73585..73839 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP085057 | ||
| Organism | Escherichia coli strain P24_WM1_05.20 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LHK10_RS24060 | Protein ID | WP_001312851.1 |
| Coordinates | 73585..73734 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 73778..73839 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LHK10_RS24030 (68832) | 68832..69743 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| LHK10_RS24035 (69754) | 69754..70974 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| LHK10_RS24040 (71681) | 71681..72295 | + | 615 | Protein_79 | VENN motif pre-toxin domain-containing protein | - |
| LHK10_RS24045 (72295) | 72295..72741 | - | 447 | Protein_80 | plasmid replication initiator RepA | - |
| LHK10_RS24050 (72734) | 72734..72808 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| LHK10_RS24055 (73044) | 73044..73301 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| LHK10_RS24060 (73585) | 73585..73734 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (73778) | 73778..73839 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73778) | 73778..73839 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73778) | 73778..73839 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73778) | 73778..73839 | + | 62 | NuclAT_0 | - | Antitoxin |
| LHK10_RS24065 (73978) | 73978..74160 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| LHK10_RS24070 (74261) | 74261..74877 | + | 617 | Protein_85 | IS1-like element IS1A family transposase | - |
| LHK10_RS24075 (74915) | 74915..76486 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| LHK10_RS24080 (76506) | 76506..76853 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LHK10_RS24085 (76853) | 76853..77530 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| LHK10_RS24090 (77585) | 77585..77674 | + | 90 | Protein_89 | IS1 family transposase | - |
| LHK10_RS24095 (77975) | 77975..78187 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / sitABCD | senB / iutA / iucD / iucC / iucB / iucA | 1..118805 | 118805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T220248 WP_001312851.1 NZ_CP085057:c73734-73585 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T220248 NZ_CP116988:129286-129435 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT220248 NZ_CP085057:73778-73839 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
