Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1270444..1270666 Replicon chromosome
Accession NZ_CP084894
Organism Escherichia coli strain g83

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag LHV61_RS06245 Protein ID WP_000170963.1
Coordinates 1270444..1270551 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1270599..1270666 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LHV61_RS06215 (1265753) 1265753..1266835 + 1083 WP_000804726.1 peptide chain release factor 1 -
LHV61_RS06220 (1266835) 1266835..1267668 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
LHV61_RS06225 (1267665) 1267665..1268057 + 393 WP_000200374.1 invasion regulator SirB2 -
LHV61_RS06230 (1268061) 1268061..1268870 + 810 WP_001257044.1 invasion regulator SirB1 -
LHV61_RS06235 (1268906) 1268906..1269760 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LHV61_RS06240 (1269909) 1269909..1270016 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1270064) 1270064..1270130 + 67 NuclAT_34 - -
- (1270064) 1270064..1270130 + 67 NuclAT_34 - -
- (1270064) 1270064..1270130 + 67 NuclAT_34 - -
- (1270064) 1270064..1270130 + 67 NuclAT_34 - -
- (1270064) 1270064..1270130 + 67 NuclAT_36 - -
- (1270064) 1270064..1270130 + 67 NuclAT_36 - -
- (1270064) 1270064..1270130 + 67 NuclAT_36 - -
- (1270064) 1270064..1270130 + 67 NuclAT_36 - -
- (1270064) 1270064..1270130 + 67 NuclAT_38 - -
- (1270064) 1270064..1270130 + 67 NuclAT_38 - -
- (1270064) 1270064..1270130 + 67 NuclAT_38 - -
- (1270064) 1270064..1270130 + 67 NuclAT_38 - -
- (1270064) 1270064..1270130 + 67 NuclAT_40 - -
- (1270064) 1270064..1270130 + 67 NuclAT_40 - -
- (1270064) 1270064..1270130 + 67 NuclAT_40 - -
- (1270064) 1270064..1270130 + 67 NuclAT_40 - -
- (1270064) 1270064..1270130 + 67 NuclAT_42 - -
- (1270064) 1270064..1270130 + 67 NuclAT_42 - -
- (1270064) 1270064..1270130 + 67 NuclAT_42 - -
- (1270064) 1270064..1270130 + 67 NuclAT_42 - -
- (1270064) 1270064..1270130 + 67 NuclAT_44 - -
- (1270064) 1270064..1270130 + 67 NuclAT_44 - -
- (1270064) 1270064..1270130 + 67 NuclAT_44 - -
- (1270064) 1270064..1270130 + 67 NuclAT_44 - -
- (1270066) 1270066..1270131 + 66 NuclAT_18 - -
- (1270066) 1270066..1270131 + 66 NuclAT_18 - -
- (1270066) 1270066..1270131 + 66 NuclAT_18 - -
- (1270066) 1270066..1270131 + 66 NuclAT_18 - -
- (1270066) 1270066..1270131 + 66 NuclAT_21 - -
- (1270066) 1270066..1270131 + 66 NuclAT_21 - -
- (1270066) 1270066..1270131 + 66 NuclAT_21 - -
- (1270066) 1270066..1270131 + 66 NuclAT_21 - -
- (1270066) 1270066..1270131 + 66 NuclAT_24 - -
- (1270066) 1270066..1270131 + 66 NuclAT_24 - -
- (1270066) 1270066..1270131 + 66 NuclAT_24 - -
- (1270066) 1270066..1270131 + 66 NuclAT_24 - -
- (1270066) 1270066..1270131 + 66 NuclAT_27 - -
- (1270066) 1270066..1270131 + 66 NuclAT_27 - -
- (1270066) 1270066..1270131 + 66 NuclAT_27 - -
- (1270066) 1270066..1270131 + 66 NuclAT_27 - -
- (1270066) 1270066..1270131 + 66 NuclAT_30 - -
- (1270066) 1270066..1270131 + 66 NuclAT_30 - -
- (1270066) 1270066..1270131 + 66 NuclAT_30 - -
- (1270066) 1270066..1270131 + 66 NuclAT_30 - -
- (1270066) 1270066..1270131 + 66 NuclAT_33 - -
- (1270066) 1270066..1270131 + 66 NuclAT_33 - -
- (1270066) 1270066..1270131 + 66 NuclAT_33 - -
- (1270066) 1270066..1270131 + 66 NuclAT_33 - -
LHV61_RS06245 (1270444) 1270444..1270551 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1270600) 1270600..1270665 + 66 NuclAT_35 - -
- (1270600) 1270600..1270665 + 66 NuclAT_35 - -
- (1270600) 1270600..1270665 + 66 NuclAT_35 - -
- (1270600) 1270600..1270665 + 66 NuclAT_35 - -
- (1270600) 1270600..1270665 + 66 NuclAT_37 - -
- (1270600) 1270600..1270665 + 66 NuclAT_37 - -
- (1270600) 1270600..1270665 + 66 NuclAT_37 - -
- (1270600) 1270600..1270665 + 66 NuclAT_37 - -
- (1270600) 1270600..1270665 + 66 NuclAT_39 - -
- (1270600) 1270600..1270665 + 66 NuclAT_39 - -
- (1270600) 1270600..1270665 + 66 NuclAT_39 - -
- (1270600) 1270600..1270665 + 66 NuclAT_39 - -
- (1270600) 1270600..1270665 + 66 NuclAT_41 - -
- (1270600) 1270600..1270665 + 66 NuclAT_41 - -
- (1270600) 1270600..1270665 + 66 NuclAT_41 - -
- (1270600) 1270600..1270665 + 66 NuclAT_41 - -
- (1270600) 1270600..1270665 + 66 NuclAT_43 - -
- (1270600) 1270600..1270665 + 66 NuclAT_43 - -
- (1270600) 1270600..1270665 + 66 NuclAT_43 - -
- (1270600) 1270600..1270665 + 66 NuclAT_43 - -
- (1270600) 1270600..1270665 + 66 NuclAT_45 - -
- (1270600) 1270600..1270665 + 66 NuclAT_45 - -
- (1270600) 1270600..1270665 + 66 NuclAT_45 - -
- (1270600) 1270600..1270665 + 66 NuclAT_45 - -
- (1270599) 1270599..1270666 + 68 NuclAT_17 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_17 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_17 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_17 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_20 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_20 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_20 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_20 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_23 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_23 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_23 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_23 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_26 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_26 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_26 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_26 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_29 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_29 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_29 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_29 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_32 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_32 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_32 - Antitoxin
- (1270599) 1270599..1270666 + 68 NuclAT_32 - Antitoxin
LHV61_RS06250 (1270979) 1270979..1271086 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1271134) 1271134..1271201 + 68 NuclAT_16 - -
- (1271134) 1271134..1271201 + 68 NuclAT_16 - -
- (1271134) 1271134..1271201 + 68 NuclAT_16 - -
- (1271134) 1271134..1271201 + 68 NuclAT_16 - -
- (1271134) 1271134..1271201 + 68 NuclAT_19 - -
- (1271134) 1271134..1271201 + 68 NuclAT_19 - -
- (1271134) 1271134..1271201 + 68 NuclAT_19 - -
- (1271134) 1271134..1271201 + 68 NuclAT_19 - -
- (1271134) 1271134..1271201 + 68 NuclAT_22 - -
- (1271134) 1271134..1271201 + 68 NuclAT_22 - -
- (1271134) 1271134..1271201 + 68 NuclAT_22 - -
- (1271134) 1271134..1271201 + 68 NuclAT_22 - -
- (1271134) 1271134..1271201 + 68 NuclAT_25 - -
- (1271134) 1271134..1271201 + 68 NuclAT_25 - -
- (1271134) 1271134..1271201 + 68 NuclAT_25 - -
- (1271134) 1271134..1271201 + 68 NuclAT_25 - -
- (1271134) 1271134..1271201 + 68 NuclAT_28 - -
- (1271134) 1271134..1271201 + 68 NuclAT_28 - -
- (1271134) 1271134..1271201 + 68 NuclAT_28 - -
- (1271134) 1271134..1271201 + 68 NuclAT_28 - -
- (1271134) 1271134..1271201 + 68 NuclAT_31 - -
- (1271134) 1271134..1271201 + 68 NuclAT_31 - -
- (1271134) 1271134..1271201 + 68 NuclAT_31 - -
- (1271134) 1271134..1271201 + 68 NuclAT_31 - -
LHV61_RS06255 (1271490) 1271490..1272590 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
LHV61_RS06260 (1272860) 1272860..1273090 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LHV61_RS06265 (1273248) 1273248..1273943 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
LHV61_RS06270 (1273987) 1273987..1274340 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T219858 WP_000170963.1 NZ_CP084894:c1270551-1270444 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T219858 NZ_CP116735:482326-482616 [Agrobacterium pusense]
ATGGGATTTCGCCTTTCTCTGCCTGCGGAAGAAGACGTCATCCGCATAGCGCAAGAAGGCATCGACCTATTTGGACCTCA
GCAAGCGCGAAAGTACCATCGCGAACTTTTCGCAATATTCGACTTGATATCACGGAATCCGAGGATCGCACGCGAGCGTG
GCGAGTTGTCGCCGTCGGTGCGCATTCATCCGTTCAGAGCACATCTGGTGGTCTATCGCGTTGAGGCGGACGACGACGTC
CTCATCGTCCGCGTCCGCCATGGGCACGAGGACTGGGGCAATGAGCCTTAA

Antitoxin


Download         Length: 68 bp

>AT219858 NZ_CP084894:1270599-1270666 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References