Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1270444..1270666 | Replicon | chromosome |
| Accession | NZ_CP084893 | ||
| Organism | Escherichia coli strain g94 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | LHV66_RS06245 | Protein ID | WP_000170963.1 |
| Coordinates | 1270444..1270551 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1270599..1270666 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LHV66_RS06215 (1265753) | 1265753..1266835 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| LHV66_RS06220 (1266835) | 1266835..1267668 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| LHV66_RS06225 (1267665) | 1267665..1268057 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| LHV66_RS06230 (1268061) | 1268061..1268870 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| LHV66_RS06235 (1268906) | 1268906..1269760 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| LHV66_RS06240 (1269909) | 1269909..1270016 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_34 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_34 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_34 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_34 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_36 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_36 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_36 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_36 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_38 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_38 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_38 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_38 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_40 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_40 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_40 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_40 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_42 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_42 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_42 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_42 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_44 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_44 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_44 | - | - |
| - (1270064) | 1270064..1270130 | + | 67 | NuclAT_44 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_18 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_18 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_18 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_18 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_21 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_21 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_21 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_21 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_24 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_24 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_24 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_24 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_27 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_27 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_27 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_27 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_30 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_30 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_30 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_30 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_33 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_33 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_33 | - | - |
| - (1270066) | 1270066..1270131 | + | 66 | NuclAT_33 | - | - |
| LHV66_RS06245 (1270444) | 1270444..1270551 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_35 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_35 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_35 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_35 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_37 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_37 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_37 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_37 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_39 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_39 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_39 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_39 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_41 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_41 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_41 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_41 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_43 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_43 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_43 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_43 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_45 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_45 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_45 | - | - |
| - (1270600) | 1270600..1270665 | + | 66 | NuclAT_45 | - | - |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1270599) | 1270599..1270666 | + | 68 | NuclAT_32 | - | Antitoxin |
| LHV66_RS06250 (1270979) | 1270979..1271086 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_16 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_16 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_16 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_16 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_19 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_19 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_19 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_19 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_22 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_22 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_22 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_22 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_25 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_25 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_25 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_25 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_28 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_28 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_28 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_28 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_31 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_31 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_31 | - | - |
| - (1271134) | 1271134..1271201 | + | 68 | NuclAT_31 | - | - |
| LHV66_RS06255 (1271490) | 1271490..1272590 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| LHV66_RS06260 (1272860) | 1272860..1273090 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| LHV66_RS06265 (1273248) | 1273248..1273943 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| LHV66_RS06270 (1273987) | 1273987..1274340 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T219815 WP_000170963.1 NZ_CP084893:c1270551-1270444 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T219815 NZ_CP116721:c165016-164735 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA
Antitoxin
Download Length: 68 bp
>AT219815 NZ_CP084893:1270599-1270666 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|