Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1603224..1603809 | Replicon | chromosome |
Accession | NZ_CP084578 | ||
Organism | Sulfurimonas sp. SWIR-19 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LCX93_RS08335 | Protein ID | WP_226065876.1 |
Coordinates | 1603525..1603809 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LCX93_RS08330 | Protein ID | WP_193150127.1 |
Coordinates | 1603224..1603514 (-) | Length | 97 a.a. |
Genomic Context
Location: 1598478..1598966 (489 bp)
Type: Others
Protein ID: WP_226065871.1
Type: Others
Protein ID: WP_226065871.1
Location: 1598970..1600235 (1266 bp)
Type: Others
Protein ID: WP_226065872.1
Type: Others
Protein ID: WP_226065872.1
Location: 1600287..1601393 (1107 bp)
Type: Others
Protein ID: WP_226065873.1
Type: Others
Protein ID: WP_226065873.1
Location: 1601386..1601574 (189 bp)
Type: Others
Protein ID: WP_151899980.1
Type: Others
Protein ID: WP_151899980.1
Location: 1601571..1602386 (816 bp)
Type: Others
Protein ID: WP_226065874.1
Type: Others
Protein ID: WP_226065874.1
Location: 1602386..1603060 (675 bp)
Type: Others
Protein ID: WP_226065875.1
Type: Others
Protein ID: WP_226065875.1
Location: 1603224..1603514 (291 bp)
Type: Antitoxin
Protein ID: WP_193150127.1
Type: Antitoxin
Protein ID: WP_193150127.1
Location: 1603525..1603809 (285 bp)
Type: Toxin
Protein ID: WP_226065876.1
Type: Toxin
Protein ID: WP_226065876.1
Location: 1604055..1604492 (438 bp)
Type: Others
Protein ID: WP_226065877.1
Type: Others
Protein ID: WP_226065877.1
Location: 1604495..1607596 (3102 bp)
Type: Others
Protein ID: WP_226065878.1
Type: Others
Protein ID: WP_226065878.1
Location: 1607606..1607884 (279 bp)
Type: Others
Protein ID: WP_151899975.1
Type: Others
Protein ID: WP_151899975.1
Location: 1607881..1608807 (927 bp)
Type: Others
Protein ID: WP_226065879.1
Type: Others
Protein ID: WP_226065879.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCX93_RS08300 (LCX93_08300) | 1598478..1598966 | + | 489 | WP_226065871.1 | hypothetical protein | - |
LCX93_RS08305 (LCX93_08305) | 1598970..1600235 | + | 1266 | WP_226065872.1 | O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase | - |
LCX93_RS08310 (LCX93_08310) | 1600287..1601393 | + | 1107 | WP_226065873.1 | homoserine O-acetyltransferase | - |
LCX93_RS08315 (LCX93_08315) | 1601386..1601574 | + | 189 | WP_151899980.1 | exodeoxyribonuclease VII small subunit | - |
LCX93_RS08320 (LCX93_08320) | 1601571..1602386 | + | 816 | WP_226065874.1 | carbon-nitrogen hydrolase family protein | - |
LCX93_RS08325 (LCX93_08325) | 1602386..1603060 | + | 675 | WP_226065875.1 | ThiF family adenylyltransferase | - |
LCX93_RS08330 (LCX93_08330) | 1603224..1603514 | - | 291 | WP_193150127.1 | HigA family addiction module antitoxin | Antitoxin |
LCX93_RS08335 (LCX93_08335) | 1603525..1603809 | - | 285 | WP_226065876.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LCX93_RS08345 (LCX93_08345) | 1604055..1604492 | - | 438 | WP_226065877.1 | globin | - |
LCX93_RS08350 (LCX93_08350) | 1604495..1607596 | - | 3102 | WP_226065878.1 | efflux RND transporter permease subunit | - |
LCX93_RS08355 (LCX93_08355) | 1607606..1607884 | - | 279 | WP_151899975.1 | hypothetical protein | - |
LCX93_RS08360 (LCX93_08360) | 1607881..1608807 | - | 927 | WP_226065879.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11146.80 Da Isoelectric Point: 9.7915
>T218872 WP_226065876.1 NZ_CP084578:c1603809-1603525 [Sulfurimonas sp. SWIR-19]
MIQSFKCKYTKQLFNGKYQKKFSQAVNNIGKRKLDMLDAAFALEDLKVPPSNHLEQLQGDLKGFYSIRINNQFRLIFKFE
NSNAYDIYIDDYHK
MIQSFKCKYTKQLFNGKYQKKFSQAVNNIGKRKLDMLDAAFALEDLKVPPSNHLEQLQGDLKGFYSIRINNQFRLIFKFE
NSNAYDIYIDDYHK
Download Length: 285 bp
>T218872 NZ_CP116115:c693065-692913 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 11151.02 Da Isoelectric Point: 10.0224
>AT218872 WP_193150127.1 NZ_CP084578:c1603514-1603224 [Sulfurimonas sp. SWIR-19]
MKEIRPSTHPGIILKEEFALPLNLTQAKLSKDLKVGIKTLSELYNEKRGITPLMALKLSEYFGTTPQFWLNLQNAYDLYK
TYQKQKENLKEIHRAA
MKEIRPSTHPGIILKEEFALPLNLTQAKLSKDLKVGIKTLSELYNEKRGITPLMALKLSEYFGTTPQFWLNLQNAYDLYK
TYQKQKENLKEIHRAA
Download Length: 291 bp
>AT218872 NZ_CP116115:693114-693171 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA