Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 159055..159277 Replicon chromosome
Accession NZ_CP084529
Organism Escherichia coli strain Origami2-DE3

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag LFW28_RS00855 Protein ID WP_000170955.1
Coordinates 159055..159162 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 159210..159277 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LFW28_RS00825 (154364) 154364..155446 + 1083 WP_000804726.1 peptide chain release factor 1 -
LFW28_RS00830 (155446) 155446..156279 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
LFW28_RS00835 (156276) 156276..156668 + 393 WP_000200374.1 invasion regulator SirB2 -
LFW28_RS00840 (156672) 156672..157481 + 810 WP_001257044.1 invasion regulator SirB1 -
LFW28_RS00845 (157517) 157517..158371 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LFW28_RS00850 (158520) 158520..158627 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (158675) 158675..158742 + 68 NuclAT_18 - -
- (158675) 158675..158742 + 68 NuclAT_18 - -
- (158675) 158675..158742 + 68 NuclAT_18 - -
- (158675) 158675..158742 + 68 NuclAT_18 - -
- (158675) 158675..158742 + 68 NuclAT_21 - -
- (158675) 158675..158742 + 68 NuclAT_21 - -
- (158675) 158675..158742 + 68 NuclAT_21 - -
- (158675) 158675..158742 + 68 NuclAT_21 - -
- (158675) 158675..158742 + 68 NuclAT_24 - -
- (158675) 158675..158742 + 68 NuclAT_24 - -
- (158675) 158675..158742 + 68 NuclAT_24 - -
- (158675) 158675..158742 + 68 NuclAT_24 - -
- (158675) 158675..158742 + 68 NuclAT_27 - -
- (158675) 158675..158742 + 68 NuclAT_27 - -
- (158675) 158675..158742 + 68 NuclAT_27 - -
- (158675) 158675..158742 + 68 NuclAT_27 - -
- (158675) 158675..158742 + 68 NuclAT_30 - -
- (158675) 158675..158742 + 68 NuclAT_30 - -
- (158675) 158675..158742 + 68 NuclAT_30 - -
- (158675) 158675..158742 + 68 NuclAT_30 - -
- (158675) 158675..158742 + 68 NuclAT_33 - -
- (158675) 158675..158742 + 68 NuclAT_33 - -
- (158675) 158675..158742 + 68 NuclAT_33 - -
- (158675) 158675..158742 + 68 NuclAT_33 - -
LFW28_RS00855 (159055) 159055..159162 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (159210) 159210..159277 + 68 NuclAT_19 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_19 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_19 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_19 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_22 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_22 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_22 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_22 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_25 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_25 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_25 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_25 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_28 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_28 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_28 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_28 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_31 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_31 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_31 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_31 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_34 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_34 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_34 - Antitoxin
- (159210) 159210..159277 + 68 NuclAT_34 - Antitoxin
LFW28_RS00860 (159590) 159590..159697 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (159745) 159745..159812 + 68 NuclAT_20 - -
- (159745) 159745..159812 + 68 NuclAT_20 - -
- (159745) 159745..159812 + 68 NuclAT_20 - -
- (159745) 159745..159812 + 68 NuclAT_20 - -
- (159745) 159745..159812 + 68 NuclAT_23 - -
- (159745) 159745..159812 + 68 NuclAT_23 - -
- (159745) 159745..159812 + 68 NuclAT_23 - -
- (159745) 159745..159812 + 68 NuclAT_23 - -
- (159745) 159745..159812 + 68 NuclAT_26 - -
- (159745) 159745..159812 + 68 NuclAT_26 - -
- (159745) 159745..159812 + 68 NuclAT_26 - -
- (159745) 159745..159812 + 68 NuclAT_26 - -
- (159745) 159745..159812 + 68 NuclAT_29 - -
- (159745) 159745..159812 + 68 NuclAT_29 - -
- (159745) 159745..159812 + 68 NuclAT_29 - -
- (159745) 159745..159812 + 68 NuclAT_29 - -
- (159745) 159745..159812 + 68 NuclAT_32 - -
- (159745) 159745..159812 + 68 NuclAT_32 - -
- (159745) 159745..159812 + 68 NuclAT_32 - -
- (159745) 159745..159812 + 68 NuclAT_32 - -
- (159745) 159745..159812 + 68 NuclAT_35 - -
- (159745) 159745..159812 + 68 NuclAT_35 - -
- (159745) 159745..159812 + 68 NuclAT_35 - -
- (159745) 159745..159812 + 68 NuclAT_35 - -
LFW28_RS00865 (160101) 160101..161201 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
LFW28_RS00870 (161471) 161471..161701 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LFW28_RS00875 (161859) 161859..162554 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
LFW28_RS00880 (162598) 162598..162951 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T218778 WP_000170955.1 NZ_CP084529:c159162-159055 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T218778 NZ_CP116100:1678359-1678577 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA

Antitoxin


Download         Length: 68 bp

>AT218778 NZ_CP084529:159210-159277 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References