Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37150..37419 | Replicon | plasmid p1864-2 |
| Accession | NZ_CP084494 | ||
| Organism | Klebsiella pneumoniae strain 1864 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LDL64_RS28470 | Protein ID | WP_001372321.1 |
| Coordinates | 37294..37419 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 37150..37215 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDL64_RS28440 | 32860..33387 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| LDL64_RS28445 | 33445..33678 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| LDL64_RS28450 | 33739..35762 | + | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
| LDL64_RS28455 | 35831..36265 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| LDL64_RS28460 | 36262..36981 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 36993..37217 | + | 225 | NuclAT_0 | - | - |
| - | 36993..37217 | + | 225 | NuclAT_0 | - | - |
| - | 36993..37217 | + | 225 | NuclAT_0 | - | - |
| - | 36993..37217 | + | 225 | NuclAT_0 | - | - |
| - | 37150..37215 | - | 66 | - | - | Antitoxin |
| LDL64_RS28465 | 37203..37352 | + | 150 | Protein_48 | plasmid maintenance protein Mok | - |
| LDL64_RS28470 | 37294..37419 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LDL64_RS28475 | 37738..38034 | - | 297 | Protein_50 | hypothetical protein | - |
| LDL64_RS28480 | 38334..38630 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| LDL64_RS28485 | 38741..39562 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| LDL64_RS28490 | 39859..40506 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| LDL64_RS28495 | 40783..41166 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LDL64_RS28500 | 41357..42043 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| LDL64_RS28505 | 42137..42364 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..152725 | 152725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T218688 WP_001372321.1 NZ_CP084494:37294-37419 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T218688 NZ_CP116074:4141210-4141362 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 66 bp
>AT218688 NZ_CP084494:c37215-37150 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|