Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 323816..324036 Replicon chromosome
Accession NZ_CP084055
Organism Escherichia coli strain X14-3

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag LCR13_RS01635 Protein ID WP_000170965.1
Coordinates 323816..323923 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 323970..324036 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LCR13_RS01605 319674..320507 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
LCR13_RS01610 320504..320896 + 393 WP_000200373.1 invasion regulator SirB2 -
LCR13_RS01615 320900..321709 + 810 WP_001257044.1 invasion regulator SirB1 -
LCR13_RS01620 321745..322599 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LCR13_RS01625 322746..322853 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- 322901..322967 + 67 NuclAT_45 - -
- 322901..322967 + 67 NuclAT_45 - -
- 322901..322967 + 67 NuclAT_45 - -
- 322901..322967 + 67 NuclAT_45 - -
- 322903..322966 + 64 NuclAT_16 - -
- 322903..322966 + 64 NuclAT_16 - -
- 322903..322966 + 64 NuclAT_16 - -
- 322903..322966 + 64 NuclAT_16 - -
- 322903..322966 + 64 NuclAT_19 - -
- 322903..322966 + 64 NuclAT_19 - -
- 322903..322966 + 64 NuclAT_19 - -
- 322903..322966 + 64 NuclAT_19 - -
- 322903..322966 + 64 NuclAT_22 - -
- 322903..322966 + 64 NuclAT_22 - -
- 322903..322966 + 64 NuclAT_22 - -
- 322903..322966 + 64 NuclAT_22 - -
- 322903..322966 + 64 NuclAT_25 - -
- 322903..322966 + 64 NuclAT_25 - -
- 322903..322966 + 64 NuclAT_25 - -
- 322903..322966 + 64 NuclAT_25 - -
- 322903..322966 + 64 NuclAT_29 - -
- 322903..322966 + 64 NuclAT_29 - -
- 322903..322966 + 64 NuclAT_29 - -
- 322903..322966 + 64 NuclAT_29 - -
- 322903..322966 + 64 NuclAT_32 - -
- 322903..322966 + 64 NuclAT_32 - -
- 322903..322966 + 64 NuclAT_32 - -
- 322903..322966 + 64 NuclAT_32 - -
LCR13_RS01630 323281..323388 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 323436..323501 + 66 NuclAT_14 - -
- 323436..323501 + 66 NuclAT_14 - -
- 323436..323501 + 66 NuclAT_14 - -
- 323436..323501 + 66 NuclAT_14 - -
- 323436..323501 + 66 NuclAT_17 - -
- 323436..323501 + 66 NuclAT_17 - -
- 323436..323501 + 66 NuclAT_17 - -
- 323436..323501 + 66 NuclAT_17 - -
- 323436..323501 + 66 NuclAT_20 - -
- 323436..323501 + 66 NuclAT_20 - -
- 323436..323501 + 66 NuclAT_20 - -
- 323436..323501 + 66 NuclAT_20 - -
- 323436..323501 + 66 NuclAT_23 - -
- 323436..323501 + 66 NuclAT_23 - -
- 323436..323501 + 66 NuclAT_23 - -
- 323436..323501 + 66 NuclAT_23 - -
- 323436..323501 + 66 NuclAT_27 - -
- 323436..323501 + 66 NuclAT_27 - -
- 323436..323501 + 66 NuclAT_27 - -
- 323436..323501 + 66 NuclAT_27 - -
- 323436..323501 + 66 NuclAT_30 - -
- 323436..323501 + 66 NuclAT_30 - -
- 323436..323501 + 66 NuclAT_30 - -
- 323436..323501 + 66 NuclAT_30 - -
- 323436..323503 + 68 NuclAT_33 - -
- 323436..323503 + 68 NuclAT_33 - -
- 323436..323503 + 68 NuclAT_33 - -
- 323436..323503 + 68 NuclAT_33 - -
- 323436..323503 + 68 NuclAT_35 - -
- 323436..323503 + 68 NuclAT_35 - -
- 323436..323503 + 68 NuclAT_35 - -
- 323436..323503 + 68 NuclAT_35 - -
- 323436..323503 + 68 NuclAT_37 - -
- 323436..323503 + 68 NuclAT_37 - -
- 323436..323503 + 68 NuclAT_37 - -
- 323436..323503 + 68 NuclAT_37 - -
- 323436..323503 + 68 NuclAT_39 - -
- 323436..323503 + 68 NuclAT_39 - -
- 323436..323503 + 68 NuclAT_39 - -
- 323436..323503 + 68 NuclAT_39 - -
- 323436..323503 + 68 NuclAT_41 - -
- 323436..323503 + 68 NuclAT_41 - -
- 323436..323503 + 68 NuclAT_41 - -
- 323436..323503 + 68 NuclAT_41 - -
- 323436..323503 + 68 NuclAT_43 - -
- 323436..323503 + 68 NuclAT_43 - -
- 323436..323503 + 68 NuclAT_43 - -
- 323436..323503 + 68 NuclAT_43 - -
- 323437..323502 + 66 NuclAT_46 - -
- 323437..323502 + 66 NuclAT_46 - -
- 323437..323502 + 66 NuclAT_46 - -
- 323437..323502 + 66 NuclAT_46 - -
LCR13_RS01635 323816..323923 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 323970..324036 + 67 - - Antitoxin
LCR13_RS01640 324328..325428 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LCR13_RS01645 325698..325928 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LCR13_RS01650 326086..326781 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LCR13_RS01655 326825..327178 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
LCR13_RS01660 327364..328758 + 1395 WP_001400233.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T218027 WP_000170965.1 NZ_CP084055:c323923-323816 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T218027 NZ_CP115447:c443058-442465 [Mycobacterium tuberculosis]
GTGAAGCGGCTCGATCTGGTCGCCGGGCCCAACGGCGCCGGCAAGTCGACGTTCGTCGCCCTCACGCTGGCGCCCTTGCT
GCCCGGCATCGTCTTCGTCAACGCCGACGAAATCGCCAAACAACGCTGGCCCGACGACCCAACATCGCACGCCTACCAGG
CGGCGCAGGTCGCCGCCGACACCCGCGCGAGGCTCATCGACTTGGGCCGGCCGTTCATTGCCGAGACGGTGTTCTCGCAC
CCATCGAAGCTCGAGCTCATCCGCACCGCGCGCACGGCCGGCTACACCGTCGTACTGCACGTGTTGGTTATCCCCGAAGG
CCTGGCGGTCGAGCGCGTCAGGCATCGCGTCGCCGCGGGCGGCCACGATGTGCCGGAGACCAAGATCCGCGAGCGTCACC
GCCGGCTGGCCGAGCTTGTCGCCCAGGCCATCACGCTGGCCGACGGCGCCACCGTCTATGACAACAGCCGGCTCGCGGGC
CCGCGGATCGTCGCTCAGTTCAGCGGGGGTGGCATCATCGGGCGCGCATGCTGGCCTTCGTGGACGCCGCCACCCTTGAT
GTCACGCTGGAGTAACAGGCCTGAGACGGCGTAA

Antitoxin


Download         Length: 67 bp

>AT218027 NZ_CP084055:323970-324036 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References