Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 323281..323501 | Replicon | chromosome |
Accession | NZ_CP084055 | ||
Organism | Escherichia coli strain X14-3 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | LCR13_RS01630 | Protein ID | WP_000170963.1 |
Coordinates | 323281..323388 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 323435..323501 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCR13_RS01600 | 318592..319674 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
LCR13_RS01605 | 319674..320507 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
LCR13_RS01610 | 320504..320896 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
LCR13_RS01615 | 320900..321709 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
LCR13_RS01620 | 321745..322599 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
LCR13_RS01625 | 322746..322853 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 322901..322967 | + | 67 | NuclAT_45 | - | - |
- | 322901..322967 | + | 67 | NuclAT_45 | - | - |
- | 322901..322967 | + | 67 | NuclAT_45 | - | - |
- | 322901..322967 | + | 67 | NuclAT_45 | - | - |
- | 322903..322966 | + | 64 | NuclAT_16 | - | - |
- | 322903..322966 | + | 64 | NuclAT_16 | - | - |
- | 322903..322966 | + | 64 | NuclAT_16 | - | - |
- | 322903..322966 | + | 64 | NuclAT_16 | - | - |
- | 322903..322966 | + | 64 | NuclAT_19 | - | - |
- | 322903..322966 | + | 64 | NuclAT_19 | - | - |
- | 322903..322966 | + | 64 | NuclAT_19 | - | - |
- | 322903..322966 | + | 64 | NuclAT_19 | - | - |
- | 322903..322966 | + | 64 | NuclAT_22 | - | - |
- | 322903..322966 | + | 64 | NuclAT_22 | - | - |
- | 322903..322966 | + | 64 | NuclAT_22 | - | - |
- | 322903..322966 | + | 64 | NuclAT_22 | - | - |
- | 322903..322966 | + | 64 | NuclAT_25 | - | - |
- | 322903..322966 | + | 64 | NuclAT_25 | - | - |
- | 322903..322966 | + | 64 | NuclAT_25 | - | - |
- | 322903..322966 | + | 64 | NuclAT_25 | - | - |
- | 322903..322966 | + | 64 | NuclAT_29 | - | - |
- | 322903..322966 | + | 64 | NuclAT_29 | - | - |
- | 322903..322966 | + | 64 | NuclAT_29 | - | - |
- | 322903..322966 | + | 64 | NuclAT_29 | - | - |
- | 322903..322966 | + | 64 | NuclAT_32 | - | - |
- | 322903..322966 | + | 64 | NuclAT_32 | - | - |
- | 322903..322966 | + | 64 | NuclAT_32 | - | - |
- | 322903..322966 | + | 64 | NuclAT_32 | - | - |
LCR13_RS01630 | 323281..323388 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 323435..323501 | + | 67 | - | - | Antitoxin |
LCR13_RS01635 | 323816..323923 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 323971..324036 | + | 66 | NuclAT_15 | - | - |
- | 323971..324036 | + | 66 | NuclAT_15 | - | - |
- | 323971..324036 | + | 66 | NuclAT_15 | - | - |
- | 323971..324036 | + | 66 | NuclAT_15 | - | - |
- | 323971..324036 | + | 66 | NuclAT_18 | - | - |
- | 323971..324036 | + | 66 | NuclAT_18 | - | - |
- | 323971..324036 | + | 66 | NuclAT_18 | - | - |
- | 323971..324036 | + | 66 | NuclAT_18 | - | - |
- | 323971..324036 | + | 66 | NuclAT_21 | - | - |
- | 323971..324036 | + | 66 | NuclAT_21 | - | - |
- | 323971..324036 | + | 66 | NuclAT_21 | - | - |
- | 323971..324036 | + | 66 | NuclAT_21 | - | - |
- | 323971..324036 | + | 66 | NuclAT_24 | - | - |
- | 323971..324036 | + | 66 | NuclAT_24 | - | - |
- | 323971..324036 | + | 66 | NuclAT_24 | - | - |
- | 323971..324036 | + | 66 | NuclAT_24 | - | - |
- | 323971..324036 | + | 66 | NuclAT_28 | - | - |
- | 323971..324036 | + | 66 | NuclAT_28 | - | - |
- | 323971..324036 | + | 66 | NuclAT_28 | - | - |
- | 323971..324036 | + | 66 | NuclAT_28 | - | - |
- | 323971..324036 | + | 66 | NuclAT_31 | - | - |
- | 323971..324036 | + | 66 | NuclAT_31 | - | - |
- | 323971..324036 | + | 66 | NuclAT_31 | - | - |
- | 323971..324036 | + | 66 | NuclAT_31 | - | - |
- | 323971..324038 | + | 68 | NuclAT_34 | - | - |
- | 323971..324038 | + | 68 | NuclAT_34 | - | - |
- | 323971..324038 | + | 68 | NuclAT_34 | - | - |
- | 323971..324038 | + | 68 | NuclAT_34 | - | - |
- | 323971..324038 | + | 68 | NuclAT_36 | - | - |
- | 323971..324038 | + | 68 | NuclAT_36 | - | - |
- | 323971..324038 | + | 68 | NuclAT_36 | - | - |
- | 323971..324038 | + | 68 | NuclAT_36 | - | - |
- | 323971..324038 | + | 68 | NuclAT_38 | - | - |
- | 323971..324038 | + | 68 | NuclAT_38 | - | - |
- | 323971..324038 | + | 68 | NuclAT_38 | - | - |
- | 323971..324038 | + | 68 | NuclAT_38 | - | - |
- | 323971..324038 | + | 68 | NuclAT_40 | - | - |
- | 323971..324038 | + | 68 | NuclAT_40 | - | - |
- | 323971..324038 | + | 68 | NuclAT_40 | - | - |
- | 323971..324038 | + | 68 | NuclAT_40 | - | - |
- | 323971..324038 | + | 68 | NuclAT_42 | - | - |
- | 323971..324038 | + | 68 | NuclAT_42 | - | - |
- | 323971..324038 | + | 68 | NuclAT_42 | - | - |
- | 323971..324038 | + | 68 | NuclAT_42 | - | - |
- | 323971..324038 | + | 68 | NuclAT_44 | - | - |
- | 323971..324038 | + | 68 | NuclAT_44 | - | - |
- | 323971..324038 | + | 68 | NuclAT_44 | - | - |
- | 323971..324038 | + | 68 | NuclAT_44 | - | - |
LCR13_RS01640 | 324328..325428 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
LCR13_RS01645 | 325698..325928 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
LCR13_RS01650 | 326086..326781 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
LCR13_RS01655 | 326825..327178 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T218025 WP_000170963.1 NZ_CP084055:c323388-323281 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T218025 NZ_CP115447:361803-362105 [Mycobacterium tuberculosis]
TTGATCGCTCCCGGCGACATCGCGCCGCGCCGCGACAGTGAACACGAGCTCTACGTCGCCGTCTTGTCCAACGCGCTCCA
TCGGGCCGCGGACACCGGACGGGTGATCACCTGCCCATTCATTCCGGGCCGGGTCCCCGAGGATCTCTTGGCGATGGTGG
TGGCGGTCGAGCAACCCAACGGCACGCTGCTGCCGGAACTCGTGCAGTGGCTTCATGTTGCCGCGCTCGGTGCGCCACTC
GGCAACGCGGGCGTGGCCGCCCTACGCGAGGCTGCCTCGGTCGTGACAGCTCTGCTCTGTTAG
TTGATCGCTCCCGGCGACATCGCGCCGCGCCGCGACAGTGAACACGAGCTCTACGTCGCCGTCTTGTCCAACGCGCTCCA
TCGGGCCGCGGACACCGGACGGGTGATCACCTGCCCATTCATTCCGGGCCGGGTCCCCGAGGATCTCTTGGCGATGGTGG
TGGCGGTCGAGCAACCCAACGGCACGCTGCTGCCGGAACTCGTGCAGTGGCTTCATGTTGCCGCGCTCGGTGCGCCACTC
GGCAACGCGGGCGTGGCCGCCCTACGCGAGGCTGCCTCGGTCGTGACAGCTCTGCTCTGTTAG
Antitoxin
Download Length: 67 bp
>AT218025 NZ_CP084055:323435-323501 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|