Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1282892..1283113 Replicon chromosome
Accession NC_008563
Organism Escherichia coli APEC O1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag APECO1_RS06440 Protein ID WP_000170954.1
Coordinates 1282892..1282999 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1283052..1283113 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APECO1_RS06415 1278737..1279819 + 1083 WP_000804726.1 peptide chain release factor 1 -
APECO1_RS06420 1279819..1280652 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
APECO1_RS06425 1280649..1281041 + 393 WP_000200375.1 invasion regulator SirB2 -
APECO1_RS06430 1281045..1281854 + 810 WP_001257054.1 invasion regulator SirB1 -
APECO1_RS06435 1281890..1282744 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
APECO1_RS06440 1282892..1282999 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1283052..1283113 + 62 NuclAT_13 - Antitoxin
- 1283052..1283113 + 62 NuclAT_13 - Antitoxin
- 1283052..1283113 + 62 NuclAT_13 - Antitoxin
- 1283052..1283113 + 62 NuclAT_13 - Antitoxin
- 1283052..1283113 + 62 NuclAT_14 - Antitoxin
- 1283052..1283113 + 62 NuclAT_14 - Antitoxin
- 1283052..1283113 + 62 NuclAT_14 - Antitoxin
- 1283052..1283113 + 62 NuclAT_14 - Antitoxin
- 1283052..1283113 + 62 NuclAT_15 - Antitoxin
- 1283052..1283113 + 62 NuclAT_15 - Antitoxin
- 1283052..1283113 + 62 NuclAT_15 - Antitoxin
- 1283052..1283113 + 62 NuclAT_15 - Antitoxin
- 1283052..1283113 + 62 NuclAT_16 - Antitoxin
- 1283052..1283113 + 62 NuclAT_16 - Antitoxin
- 1283052..1283113 + 62 NuclAT_16 - Antitoxin
- 1283052..1283113 + 62 NuclAT_16 - Antitoxin
- 1283052..1283113 + 62 NuclAT_17 - Antitoxin
- 1283052..1283113 + 62 NuclAT_17 - Antitoxin
- 1283052..1283113 + 62 NuclAT_17 - Antitoxin
- 1283052..1283113 + 62 NuclAT_17 - Antitoxin
- 1283052..1283113 + 62 NuclAT_18 - Antitoxin
- 1283052..1283113 + 62 NuclAT_18 - Antitoxin
- 1283052..1283113 + 62 NuclAT_18 - Antitoxin
- 1283052..1283113 + 62 NuclAT_18 - Antitoxin
- 1283052..1283114 + 63 NuclAT_10 - -
- 1283052..1283114 + 63 NuclAT_10 - -
- 1283052..1283114 + 63 NuclAT_10 - -
- 1283052..1283114 + 63 NuclAT_10 - -
- 1283052..1283114 + 63 NuclAT_11 - -
- 1283052..1283114 + 63 NuclAT_11 - -
- 1283052..1283114 + 63 NuclAT_11 - -
- 1283052..1283114 + 63 NuclAT_11 - -
- 1283052..1283114 + 63 NuclAT_12 - -
- 1283052..1283114 + 63 NuclAT_12 - -
- 1283052..1283114 + 63 NuclAT_12 - -
- 1283052..1283114 + 63 NuclAT_12 - -
- 1283052..1283114 + 63 NuclAT_7 - -
- 1283052..1283114 + 63 NuclAT_7 - -
- 1283052..1283114 + 63 NuclAT_7 - -
- 1283052..1283114 + 63 NuclAT_7 - -
- 1283052..1283114 + 63 NuclAT_8 - -
- 1283052..1283114 + 63 NuclAT_8 - -
- 1283052..1283114 + 63 NuclAT_8 - -
- 1283052..1283114 + 63 NuclAT_8 - -
- 1283052..1283114 + 63 NuclAT_9 - -
- 1283052..1283114 + 63 NuclAT_9 - -
- 1283052..1283114 + 63 NuclAT_9 - -
- 1283052..1283114 + 63 NuclAT_9 - -
- 1283052..1283115 + 64 NuclAT_19 - -
- 1283052..1283115 + 64 NuclAT_19 - -
- 1283052..1283115 + 64 NuclAT_19 - -
- 1283052..1283115 + 64 NuclAT_19 - -
- 1283052..1283115 + 64 NuclAT_20 - -
- 1283052..1283115 + 64 NuclAT_20 - -
- 1283052..1283115 + 64 NuclAT_20 - -
- 1283052..1283115 + 64 NuclAT_20 - -
- 1283052..1283115 + 64 NuclAT_21 - -
- 1283052..1283115 + 64 NuclAT_21 - -
- 1283052..1283115 + 64 NuclAT_21 - -
- 1283052..1283115 + 64 NuclAT_21 - -
- 1283052..1283115 + 64 NuclAT_22 - -
- 1283052..1283115 + 64 NuclAT_22 - -
- 1283052..1283115 + 64 NuclAT_22 - -
- 1283052..1283115 + 64 NuclAT_22 - -
- 1283052..1283115 + 64 NuclAT_23 - -
- 1283052..1283115 + 64 NuclAT_23 - -
- 1283052..1283115 + 64 NuclAT_23 - -
- 1283052..1283115 + 64 NuclAT_23 - -
- 1283052..1283115 + 64 NuclAT_24 - -
- 1283052..1283115 + 64 NuclAT_24 - -
- 1283052..1283115 + 64 NuclAT_24 - -
- 1283052..1283115 + 64 NuclAT_24 - -
APECO1_RS06445 1283405..1284505 - 1101 WP_024179260.1 sodium-potassium/proton antiporter ChaA -
APECO1_RS06450 1284775..1285005 + 231 WP_001146444.1 putative cation transport regulator ChaB -
APECO1_RS06455 1285163..1285858 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
APECO1_RS06460 1285902..1286255 - 354 WP_001169658.1 DsrE/F sulfur relay family protein YchN -
APECO1_RS06465 1286440..1287834 + 1395 WP_000086189.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T21746 WP_000170954.1 NC_008563:c1282999-1282892 [Escherichia coli APEC O1]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T21746 NC_008563:c1282999-1282892 [Escherichia coli APEC O1]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT21746 NC_008563:1283052-1283113 [Escherichia coli APEC O1]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References