Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36889..37153 | Replicon | plasmid p1606c |
Accession | NZ_CP083704 | ||
Organism | Escherichia coli strain SUISSEKPC3NDM5 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | K9O95_RS25860 | Protein ID | WP_001387489.1 |
Coordinates | 37001..37153 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 36889..36949 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K9O95_RS28140 (32999) | 32999..33277 | + | 279 | WP_219334566.1 | ash family protein | - |
K9O95_RS25835 (33195) | 33195..33482 | + | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
K9O95_RS25840 (33924) | 33924..34232 | + | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
K9O95_RS25850 (34996) | 34996..36153 | - | 1158 | Protein_46 | IS1380-like element ISEcp1 family transposase | - |
K9O95_RS25855 (36306) | 36306..36680 | - | 375 | WP_223349261.1 | hypothetical protein | - |
- (36889) | 36889..36949 | - | 61 | NuclAT_0 | - | Antitoxin |
- (36889) | 36889..36949 | - | 61 | NuclAT_0 | - | Antitoxin |
- (36889) | 36889..36949 | - | 61 | NuclAT_0 | - | Antitoxin |
- (36889) | 36889..36949 | - | 61 | NuclAT_0 | - | Antitoxin |
K9O95_RS25860 (37001) | 37001..37153 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
K9O95_RS25865 (37225) | 37225..37476 | - | 252 | WP_001291964.1 | hypothetical protein | - |
K9O95_RS25870 (37776) | 37776..38072 | + | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
K9O95_RS25875 (38137) | 38137..38313 | - | 177 | WP_001054897.1 | hypothetical protein | - |
K9O95_RS25880 (38705) | 38705..38914 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
K9O95_RS25885 (38986) | 38986..39084 | - | 99 | Protein_53 | ethanolamine utilization protein EutE | - |
K9O95_RS25890 (39139) | 39139..39836 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
K9O95_RS25895 (39852) | 39852..39965 | + | 114 | Protein_55 | transposase | - |
K9O95_RS25900 (40289) | 40289..41434 | + | 1146 | WP_075985684.1 | class C beta-lactamase CMY-145 | - |
K9O95_RS25905 (41528) | 41528..42061 | + | 534 | WP_001221666.1 | lipocalin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCMY-145 | - | 1..58698 | 58698 | |
- | inside | IScluster/Tn | blaCMY-145 | - | 34665..41434 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T217126 WP_001387489.1 NZ_CP083704:37001-37153 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T217126 NZ_CP113865:c1728189-1727926 [Caldicellulosiruptor morganii]
ATGGGATATAAATTAAAGTTTTCAAAATATGCTTTAAAAGATGCAAAGAAACTAGAAGAATGCGGATTGGATAAAAAAGC
AAAGGAAATTTTAAGAATATTAAAAGAAAATCTATATCAAAATCCGCCACCTTATGAGAAATTAAAAGGAGAGCTAAGTG
GCAAGTTTTCAAGAAGAATAAACATACAGCATAGGATAATATACGAAGTTTTAGAAGAAGAAAAGATTGTTAAAATTTAT
AGGATGTGGACACACTACGAATAG
ATGGGATATAAATTAAAGTTTTCAAAATATGCTTTAAAAGATGCAAAGAAACTAGAAGAATGCGGATTGGATAAAAAAGC
AAAGGAAATTTTAAGAATATTAAAAGAAAATCTATATCAAAATCCGCCACCTTATGAGAAATTAAAAGGAGAGCTAAGTG
GCAAGTTTTCAAGAAGAATAAACATACAGCATAGGATAATATACGAAGTTTTAGAAGAAGAAAAGATTGTTAAAATTTAT
AGGATGTGGACACACTACGAATAG
Antitoxin
Download Length: 61 bp
>AT217126 NZ_CP083704:c36949-36889 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|