Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4047128..4047349 Replicon chromosome
Accession NZ_CP083530
Organism Escherichia coli strain elppa2

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1D7PZ30
Locus tag K9U05_RS18965 Protein ID WP_022645587.1
Coordinates 4047128..4047235 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4047283..4047349 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K9U05_RS18940 (4042972) 4042972..4044054 + 1083 WP_022645584.1 peptide chain release factor 1 -
K9U05_RS18945 (4044054) 4044054..4044887 + 834 WP_228612424.1 peptide chain release factor N(5)-glutamine methyltransferase -
K9U05_RS18950 (4044884) 4044884..4045276 + 393 WP_000200374.1 invasion regulator SirB2 -
K9U05_RS18955 (4045280) 4045280..4046089 + 810 WP_088845989.1 invasion regulator SirB1 -
K9U05_RS18960 (4046125) 4046125..4046979 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
K9U05_RS18965 (4047128) 4047128..4047235 - 108 WP_022645587.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4047285) 4047285..4047342 + 58 NuclAT_42 - -
- (4047285) 4047285..4047342 + 58 NuclAT_42 - -
- (4047285) 4047285..4047342 + 58 NuclAT_42 - -
- (4047285) 4047285..4047342 + 58 NuclAT_42 - -
- (4047285) 4047285..4047342 + 58 NuclAT_44 - -
- (4047285) 4047285..4047342 + 58 NuclAT_44 - -
- (4047285) 4047285..4047342 + 58 NuclAT_44 - -
- (4047285) 4047285..4047342 + 58 NuclAT_44 - -
- (4047285) 4047285..4047342 + 58 NuclAT_46 - -
- (4047285) 4047285..4047342 + 58 NuclAT_46 - -
- (4047285) 4047285..4047342 + 58 NuclAT_46 - -
- (4047285) 4047285..4047342 + 58 NuclAT_46 - -
- (4047283) 4047283..4047349 + 67 NuclAT_29 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_29 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_29 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_29 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_31 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_31 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_31 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_31 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_33 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_33 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_33 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_33 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_35 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_35 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_35 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_35 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_37 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_37 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_37 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_37 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_39 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_39 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_39 - Antitoxin
- (4047283) 4047283..4047349 + 67 NuclAT_39 - Antitoxin
K9U05_RS18975 (4049110) 4049110..4049217 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4049270) 4049270..4049331 + 62 NuclAT_41 - -
- (4049270) 4049270..4049331 + 62 NuclAT_41 - -
- (4049270) 4049270..4049331 + 62 NuclAT_41 - -
- (4049270) 4049270..4049331 + 62 NuclAT_41 - -
- (4049270) 4049270..4049331 + 62 NuclAT_43 - -
- (4049270) 4049270..4049331 + 62 NuclAT_43 - -
- (4049270) 4049270..4049331 + 62 NuclAT_43 - -
- (4049270) 4049270..4049331 + 62 NuclAT_43 - -
- (4049270) 4049270..4049331 + 62 NuclAT_45 - -
- (4049270) 4049270..4049331 + 62 NuclAT_45 - -
- (4049270) 4049270..4049331 + 62 NuclAT_45 - -
- (4049270) 4049270..4049331 + 62 NuclAT_45 - -
- (4049270) 4049270..4049332 + 63 NuclAT_30 - -
- (4049270) 4049270..4049332 + 63 NuclAT_30 - -
- (4049270) 4049270..4049332 + 63 NuclAT_30 - -
- (4049270) 4049270..4049332 + 63 NuclAT_30 - -
- (4049270) 4049270..4049332 + 63 NuclAT_32 - -
- (4049270) 4049270..4049332 + 63 NuclAT_32 - -
- (4049270) 4049270..4049332 + 63 NuclAT_32 - -
- (4049270) 4049270..4049332 + 63 NuclAT_32 - -
- (4049270) 4049270..4049332 + 63 NuclAT_34 - -
- (4049270) 4049270..4049332 + 63 NuclAT_34 - -
- (4049270) 4049270..4049332 + 63 NuclAT_34 - -
- (4049270) 4049270..4049332 + 63 NuclAT_34 - -
- (4049270) 4049270..4049332 + 63 NuclAT_36 - -
- (4049270) 4049270..4049332 + 63 NuclAT_36 - -
- (4049270) 4049270..4049332 + 63 NuclAT_36 - -
- (4049270) 4049270..4049332 + 63 NuclAT_36 - -
- (4049270) 4049270..4049332 + 63 NuclAT_38 - -
- (4049270) 4049270..4049332 + 63 NuclAT_38 - -
- (4049270) 4049270..4049332 + 63 NuclAT_38 - -
- (4049270) 4049270..4049332 + 63 NuclAT_38 - -
- (4049270) 4049270..4049332 + 63 NuclAT_40 - -
- (4049270) 4049270..4049332 + 63 NuclAT_40 - -
- (4049270) 4049270..4049332 + 63 NuclAT_40 - -
- (4049270) 4049270..4049332 + 63 NuclAT_40 - -
K9U05_RS18980 (4049623) 4049623..4050723 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
K9U05_RS18985 (4050993) 4050993..4051223 + 231 WP_001146444.1 putative cation transport regulator ChaB -
K9U05_RS18990 (4051381) 4051381..4052076 + 696 WP_228612428.1 glutathione-specific gamma-glutamylcyclotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4029.82 Da        Isoelectric Point: 11.4779

>T216732 WP_022645587.1 NZ_CP083530:c4047235-4047128 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T216732 NZ_CP113246:6109881-6110162 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA

Antitoxin


Download         Length: 67 bp

>AT216732 NZ_CP083530:4047283-4047349 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D7PZ30

Antitoxin

Download structure file

References