Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1610976..1611195 Replicon chromosome
Accession NZ_CP083530
Organism Escherichia coli strain elppa2

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag K9U05_RS07580 Protein ID WP_000170738.1
Coordinates 1610976..1611083 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1611140..1611195 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K9U05_RS07555 (1606541) 1606541..1606699 - 159 WP_228613356.1 cellulose biosynthesis protein BcsR -
K9U05_RS07560 (1606971) 1606971..1608542 + 1572 WP_001204946.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
K9U05_RS07565 (1608539) 1608539..1608730 + 192 WP_094318154.1 cellulose biosynthesis protein BcsF -
K9U05_RS07570 (1608727) 1608727..1610406 + 1680 Protein_1479 cellulose biosynthesis protein BcsG -
K9U05_RS07575 (1610492) 1610492..1610599 - 108 WP_000170736.1 type I toxin-antitoxin system toxin Ldr family protein -
K9U05_RS07580 (1610976) 1610976..1611083 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1611140) 1611140..1611195 + 56 NuclAT_18 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_18 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_18 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_18 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_21 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_21 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_21 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_21 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_24 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_24 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_24 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_24 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_27 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_27 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_27 - Antitoxin
- (1611140) 1611140..1611195 + 56 NuclAT_27 - Antitoxin
- (1611140) 1611140..1611197 + 58 NuclAT_12 - -
- (1611140) 1611140..1611197 + 58 NuclAT_12 - -
- (1611140) 1611140..1611197 + 58 NuclAT_12 - -
- (1611140) 1611140..1611197 + 58 NuclAT_12 - -
- (1611140) 1611140..1611197 + 58 NuclAT_15 - -
- (1611140) 1611140..1611197 + 58 NuclAT_15 - -
- (1611140) 1611140..1611197 + 58 NuclAT_15 - -
- (1611140) 1611140..1611197 + 58 NuclAT_15 - -
K9U05_RS07585 (1611460) 1611460..1611567 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1611616) 1611616..1611679 + 64 NuclAT_19 - -
- (1611616) 1611616..1611679 + 64 NuclAT_19 - -
- (1611616) 1611616..1611679 + 64 NuclAT_19 - -
- (1611616) 1611616..1611679 + 64 NuclAT_19 - -
- (1611616) 1611616..1611679 + 64 NuclAT_22 - -
- (1611616) 1611616..1611679 + 64 NuclAT_22 - -
- (1611616) 1611616..1611679 + 64 NuclAT_22 - -
- (1611616) 1611616..1611679 + 64 NuclAT_22 - -
- (1611616) 1611616..1611679 + 64 NuclAT_25 - -
- (1611616) 1611616..1611679 + 64 NuclAT_25 - -
- (1611616) 1611616..1611679 + 64 NuclAT_25 - -
- (1611616) 1611616..1611679 + 64 NuclAT_25 - -
- (1611616) 1611616..1611679 + 64 NuclAT_28 - -
- (1611616) 1611616..1611679 + 64 NuclAT_28 - -
- (1611616) 1611616..1611679 + 64 NuclAT_28 - -
- (1611616) 1611616..1611679 + 64 NuclAT_28 - -
- (1611616) 1611616..1611681 + 66 NuclAT_13 - -
- (1611616) 1611616..1611681 + 66 NuclAT_13 - -
- (1611616) 1611616..1611681 + 66 NuclAT_13 - -
- (1611616) 1611616..1611681 + 66 NuclAT_13 - -
- (1611616) 1611616..1611681 + 66 NuclAT_16 - -
- (1611616) 1611616..1611681 + 66 NuclAT_16 - -
- (1611616) 1611616..1611681 + 66 NuclAT_16 - -
- (1611616) 1611616..1611681 + 66 NuclAT_16 - -
K9U05_RS07590 (1611942) 1611942..1612049 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1612098) 1612098..1612161 + 64 NuclAT_17 - -
- (1612098) 1612098..1612161 + 64 NuclAT_17 - -
- (1612098) 1612098..1612161 + 64 NuclAT_17 - -
- (1612098) 1612098..1612161 + 64 NuclAT_17 - -
- (1612098) 1612098..1612161 + 64 NuclAT_20 - -
- (1612098) 1612098..1612161 + 64 NuclAT_20 - -
- (1612098) 1612098..1612161 + 64 NuclAT_20 - -
- (1612098) 1612098..1612161 + 64 NuclAT_20 - -
- (1612098) 1612098..1612161 + 64 NuclAT_23 - -
- (1612098) 1612098..1612161 + 64 NuclAT_23 - -
- (1612098) 1612098..1612161 + 64 NuclAT_23 - -
- (1612098) 1612098..1612161 + 64 NuclAT_23 - -
- (1612098) 1612098..1612161 + 64 NuclAT_26 - -
- (1612098) 1612098..1612161 + 64 NuclAT_26 - -
- (1612098) 1612098..1612161 + 64 NuclAT_26 - -
- (1612098) 1612098..1612161 + 64 NuclAT_26 - -
- (1612098) 1612098..1612163 + 66 NuclAT_11 - -
- (1612098) 1612098..1612163 + 66 NuclAT_11 - -
- (1612098) 1612098..1612163 + 66 NuclAT_11 - -
- (1612098) 1612098..1612163 + 66 NuclAT_11 - -
- (1612098) 1612098..1612163 + 66 NuclAT_14 - -
- (1612098) 1612098..1612163 + 66 NuclAT_14 - -
- (1612098) 1612098..1612163 + 66 NuclAT_14 - -
- (1612098) 1612098..1612163 + 66 NuclAT_14 - -
K9U05_RS07595 (1612525) 1612525..1613796 + 1272 WP_228613358.1 amino acid permease -
K9U05_RS07600 (1613826) 1613826..1614830 - 1005 WP_000107033.1 dipeptide ABC transporter ATP-binding subunit DppF -
K9U05_RS07605 (1614827) 1614827..1615810 - 984 WP_001196481.1 dipeptide ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T216717 WP_000170738.1 NZ_CP083530:c1611083-1610976 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T216717 NZ_CP113236:2259136-2259426 [Pasteurella multocida]
ATGAGTAAAAAAGTAGAATTAAAACCATTTGATATTGCTGAATACCTAGATAGTGAAGAAATGATTGCGGCATATTTAAG
TGAAATTTTAGAAACAGGTGACACTAATGAATTTATTTCTGCGCTAGGTGATGTCGCAAGAGCGAGAGGAATGACGGAGT
TAGCGGCAAAAACAGGATTAGGAAGAGAAAGTCTCTATAAAACATTATCACACGGAAGTAAGCCGCGTTTTGATACTATA
ATGAAAATTACGCAAGCACTAGGTATTAAACTTGTCCCAACGCATATCTAA

Antitoxin


Download         Length: 56 bp

>AT216717 NZ_CP083530:1611140-1611195 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References