Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 421567..421788 Replicon chromosome
Accession NZ_CP083503
Organism Escherichia coli strain elppa5

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag K9U08_RS02130 Protein ID WP_000176713.1
Coordinates 421567..421674 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 421722..421788 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K9U08_RS02100 (416701) 416701..417783 + 1083 WP_000804726.1 peptide chain release factor 1 -
K9U08_RS02105 (417783) 417783..418616 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
K9U08_RS02110 (418613) 418613..419005 + 393 WP_000200377.1 invasion regulator SirB2 -
K9U08_RS02115 (419009) 419009..419818 + 810 WP_001257044.1 invasion regulator SirB1 -
K9U08_RS02120 (419854) 419854..420708 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
K9U08_RS02125 (420903) 420903..421361 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
K9U08_RS02130 (421567) 421567..421674 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (421724) 421724..421787 + 64 NuclAT_46 - -
- (421724) 421724..421787 + 64 NuclAT_46 - -
- (421724) 421724..421787 + 64 NuclAT_46 - -
- (421724) 421724..421787 + 64 NuclAT_46 - -
- (421724) 421724..421787 + 64 NuclAT_48 - -
- (421724) 421724..421787 + 64 NuclAT_48 - -
- (421724) 421724..421787 + 64 NuclAT_48 - -
- (421724) 421724..421787 + 64 NuclAT_48 - -
- (421722) 421722..421788 + 67 NuclAT_21 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_21 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_21 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_21 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_26 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_26 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_26 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_26 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_31 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_31 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_31 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_31 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_36 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_36 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_36 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_36 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_38 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_38 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_38 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_38 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_43 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_43 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_43 - Antitoxin
- (421722) 421722..421788 + 67 NuclAT_43 - Antitoxin
K9U08_RS02135 (422102) 422102..422209 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (422262) 422262..422323 + 62 NuclAT_45 - -
- (422262) 422262..422323 + 62 NuclAT_45 - -
- (422262) 422262..422323 + 62 NuclAT_45 - -
- (422262) 422262..422323 + 62 NuclAT_45 - -
- (422262) 422262..422323 + 62 NuclAT_47 - -
- (422262) 422262..422323 + 62 NuclAT_47 - -
- (422262) 422262..422323 + 62 NuclAT_47 - -
- (422262) 422262..422323 + 62 NuclAT_47 - -
- (422262) 422262..422324 + 63 NuclAT_22 - -
- (422262) 422262..422324 + 63 NuclAT_22 - -
- (422262) 422262..422324 + 63 NuclAT_22 - -
- (422262) 422262..422324 + 63 NuclAT_22 - -
- (422262) 422262..422324 + 63 NuclAT_27 - -
- (422262) 422262..422324 + 63 NuclAT_27 - -
- (422262) 422262..422324 + 63 NuclAT_27 - -
- (422262) 422262..422324 + 63 NuclAT_27 - -
- (422262) 422262..422324 + 63 NuclAT_32 - -
- (422262) 422262..422324 + 63 NuclAT_32 - -
- (422262) 422262..422324 + 63 NuclAT_32 - -
- (422262) 422262..422324 + 63 NuclAT_32 - -
- (422262) 422262..422324 + 63 NuclAT_37 - -
- (422262) 422262..422324 + 63 NuclAT_37 - -
- (422262) 422262..422324 + 63 NuclAT_37 - -
- (422262) 422262..422324 + 63 NuclAT_37 - -
- (422262) 422262..422324 + 63 NuclAT_39 - -
- (422262) 422262..422324 + 63 NuclAT_39 - -
- (422262) 422262..422324 + 63 NuclAT_39 - -
- (422262) 422262..422324 + 63 NuclAT_39 - -
- (422262) 422262..422324 + 63 NuclAT_44 - -
- (422262) 422262..422324 + 63 NuclAT_44 - -
- (422262) 422262..422324 + 63 NuclAT_44 - -
- (422262) 422262..422324 + 63 NuclAT_44 - -
K9U08_RS02140 (422615) 422615..423715 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
K9U08_RS02145 (423985) 423985..424215 + 231 WP_001146444.1 putative cation transport regulator ChaB -
K9U08_RS02150 (424373) 424373..425068 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
K9U08_RS02155 (425112) 425112..425465 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 420903..421361 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T216636 WP_000176713.1 NZ_CP083503:c421674-421567 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T216636 NZ_CP113192:3954600-3954818 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA

Antitoxin


Download         Length: 67 bp

>AT216636 NZ_CP083503:421722-421788 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References