Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1270238..1270460 | Replicon | chromosome |
| Accession | NZ_CP083410 | ||
| Organism | Escherichia coli strain RP437 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | LAJ62_RS06240 | Protein ID | WP_000170955.1 |
| Coordinates | 1270238..1270345 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1270393..1270460 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAJ62_RS06210 (1266094) | 1266094..1266927 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| LAJ62_RS06215 (1266924) | 1266924..1267316 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| LAJ62_RS06220 (1267320) | 1267320..1268129 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| LAJ62_RS06225 (1268165) | 1268165..1269019 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| LAJ62_RS06230 (1269168) | 1269168..1269275 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_34 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_34 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_34 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_34 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_36 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_36 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_36 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_36 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_38 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_38 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_38 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_38 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_40 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_40 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_40 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_40 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_42 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_42 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_42 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_42 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_44 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_44 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_44 | - | - |
| - (1269323) | 1269323..1269389 | + | 67 | NuclAT_44 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_18 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_18 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_18 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_18 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_21 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_21 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_21 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_21 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_24 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_24 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_24 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_24 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_27 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_27 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_27 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_27 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_30 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_30 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_30 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_30 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_33 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_33 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_33 | - | - |
| - (1269325) | 1269325..1269390 | + | 66 | NuclAT_33 | - | - |
| LAJ62_RS06235 (1269703) | 1269703..1269810 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_35 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_35 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_35 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_35 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_37 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_37 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_37 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_37 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_39 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_39 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_39 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_39 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_41 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_41 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_41 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_41 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_43 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_43 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_43 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_43 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_45 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_45 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_45 | - | - |
| - (1269859) | 1269859..1269924 | + | 66 | NuclAT_45 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_17 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_17 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_17 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_17 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_20 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_20 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_20 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_20 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_23 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_23 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_23 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_23 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_26 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_26 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_26 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_26 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_29 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_29 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_29 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_29 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_32 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_32 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_32 | - | - |
| - (1269858) | 1269858..1269925 | + | 68 | NuclAT_32 | - | - |
| LAJ62_RS06240 (1270238) | 1270238..1270345 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1270393) | 1270393..1270460 | + | 68 | NuclAT_31 | - | Antitoxin |
| LAJ62_RS06245 (1270749) | 1270749..1271849 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| LAJ62_RS06250 (1272119) | 1272119..1272349 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| LAJ62_RS06255 (1272507) | 1272507..1273202 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| LAJ62_RS06260 (1273246) | 1273246..1273599 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| LAJ62_RS06265 (1273784) | 1273784..1275178 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T216362 WP_000170955.1 NZ_CP083410:c1270345-1270238 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T216362 NZ_CP113027:c2595688-2595368 [Staphylococcus aureus]
ATGAATTGGGAAATTAAAGATTTAATGTGTGACATTGAAGTGATAAAACAAAAAATTAATGATGTAGCTACCAAACATGC
TTGGTTTGTTGAAGATAGATTTGTAAAAAATGAATTAGAAACAAAACGGGAACATATTAATTTTTCTGCTAGCTATTTAG
AACATCGTATACAAAATGAACATACAGTTGAGTTATTACATGTGTACTTAAAAGAATTCAGTGAACTTATACAAAAATTT
CATGAAATAGAAAAAGCGTCATCAGAGAACTTTGACGAGGAATCAGATGACGCAAAGAATTCAATAAAAGTAGCAGAGTA
A
ATGAATTGGGAAATTAAAGATTTAATGTGTGACATTGAAGTGATAAAACAAAAAATTAATGATGTAGCTACCAAACATGC
TTGGTTTGTTGAAGATAGATTTGTAAAAAATGAATTAGAAACAAAACGGGAACATATTAATTTTTCTGCTAGCTATTTAG
AACATCGTATACAAAATGAACATACAGTTGAGTTATTACATGTGTACTTAAAAGAATTCAGTGAACTTATACAAAAATTT
CATGAAATAGAAAAAGCGTCATCAGAGAACTTTGACGAGGAATCAGATGACGCAAAGAATTCAATAAAAGTAGCAGAGTA
A
Antitoxin
Download Length: 68 bp
>AT216362 NZ_CP083410:1270393-1270460 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|