Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4493291..4493511 Replicon chromosome
Accession NZ_CP083273
Organism Escherichia coli strain BL21-RIPL

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag K9U36_RS21920 Protein ID WP_000170963.1
Coordinates 4493291..4493398 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4493445..4493511 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K9U36_RS21895 4488971..4489648 + 678 Protein_4299 RHS repeat-associated core domain-containing protein -
K9U36_RS21900 4489648..4489974 + 327 WP_000873944.1 protein YbfB -
K9U36_RS21905 4490076..4491088 - 1013 Protein_4301 IS3-like element IS150 family transposase -
K9U36_RS21910 4491136..4492170 + 1035 Protein_4302 glutamate decarboxylase -
K9U36_RS21915 4492109..4493200 - 1092 Protein_4303 elongation factor Tu -
K9U36_RS21920 4493291..4493398 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4493445..4493511 + 67 - - Antitoxin
K9U36_RS21925 4493826..4493933 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4493981..4494046 + 66 NuclAT_17 - -
- 4493981..4494046 + 66 NuclAT_17 - -
- 4493981..4494046 + 66 NuclAT_17 - -
- 4493981..4494046 + 66 NuclAT_17 - -
- 4493981..4494046 + 66 NuclAT_20 - -
- 4493981..4494046 + 66 NuclAT_20 - -
- 4493981..4494046 + 66 NuclAT_20 - -
- 4493981..4494046 + 66 NuclAT_20 - -
- 4493981..4494046 + 66 NuclAT_23 - -
- 4493981..4494046 + 66 NuclAT_23 - -
- 4493981..4494046 + 66 NuclAT_23 - -
- 4493981..4494046 + 66 NuclAT_23 - -
- 4493981..4494046 + 66 NuclAT_26 - -
- 4493981..4494046 + 66 NuclAT_26 - -
- 4493981..4494046 + 66 NuclAT_26 - -
- 4493981..4494046 + 66 NuclAT_26 - -
- 4493981..4494046 + 66 NuclAT_29 - -
- 4493981..4494046 + 66 NuclAT_29 - -
- 4493981..4494046 + 66 NuclAT_29 - -
- 4493981..4494046 + 66 NuclAT_29 - -
- 4493981..4494046 + 66 NuclAT_32 - -
- 4493981..4494046 + 66 NuclAT_32 - -
- 4493981..4494046 + 66 NuclAT_32 - -
- 4493981..4494046 + 66 NuclAT_32 - -
- 4493981..4494048 + 68 NuclAT_35 - -
- 4493981..4494048 + 68 NuclAT_35 - -
- 4493981..4494048 + 68 NuclAT_35 - -
- 4493981..4494048 + 68 NuclAT_35 - -
- 4493981..4494048 + 68 NuclAT_38 - -
- 4493981..4494048 + 68 NuclAT_38 - -
- 4493981..4494048 + 68 NuclAT_38 - -
- 4493981..4494048 + 68 NuclAT_38 - -
- 4493981..4494048 + 68 NuclAT_41 - -
- 4493981..4494048 + 68 NuclAT_41 - -
- 4493981..4494048 + 68 NuclAT_41 - -
- 4493981..4494048 + 68 NuclAT_41 - -
- 4493981..4494048 + 68 NuclAT_44 - -
- 4493981..4494048 + 68 NuclAT_44 - -
- 4493981..4494048 + 68 NuclAT_44 - -
- 4493981..4494048 + 68 NuclAT_44 - -
- 4493981..4494048 + 68 NuclAT_47 - -
- 4493981..4494048 + 68 NuclAT_47 - -
- 4493981..4494048 + 68 NuclAT_47 - -
- 4493981..4494048 + 68 NuclAT_47 - -
- 4493981..4494048 + 68 NuclAT_50 - -
- 4493981..4494048 + 68 NuclAT_50 - -
- 4493981..4494048 + 68 NuclAT_50 - -
- 4493981..4494048 + 68 NuclAT_50 - -
- 4493982..4494047 + 66 NuclAT_53 - -
- 4493982..4494047 + 66 NuclAT_53 - -
- 4493982..4494047 + 66 NuclAT_53 - -
- 4493982..4494047 + 66 NuclAT_53 - -
- 4493982..4494047 + 66 NuclAT_56 - -
- 4493982..4494047 + 66 NuclAT_56 - -
- 4493982..4494047 + 66 NuclAT_56 - -
- 4493982..4494047 + 66 NuclAT_56 - -
K9U36_RS21930 4494270..4494377 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
K9U36_RS21935 4494753..4494860 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
K9U36_RS21940 4495117..4495814 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
K9U36_RS21945 4495830..4496477 + 648 Protein_4309 RHS element protein -
K9U36_RS22135 4496469..4496603 + 135 Protein_4310 serum resistance lipoprotein Bor -
K9U36_RS22140 4496635..4497135 - 501 WP_263300663.1 prophage endopeptidase RzpD -
K9U36_RS21965 4497086..4497514 - 429 Protein_4312 ISAs1 family transposase -
K9U36_RS21970 4497717..4497836 + 120 Protein_4313 IS3 family transposase -
K9U36_RS21975 4497934..4498086 + 153 WP_000956455.1 type I toxin-antitoxin system toxin HokE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - tufA 4476659..4496937 20278
- inside IScluster/Tn - tufA 4473015..4497514 24499


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T216258 WP_000170963.1 NZ_CP083273:c4493398-4493291 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T216258 NZ_CP112997:c2198444-2198148 [Mycobacterium tuberculosis variant bovis]
GTGAGTAGCCGATACCTTCTCTCGCCTGCCGCGCAGGCACATCTGGAAGAGATCTGGGACTGCACCTATGACCGTTGGGG
TGTCGATCAGGCCGAGCAGTACCTGCGCGAACTTCAACACGCTATCGACCGTGCTGCGGCAAACCCGCGGATCGGACGAG
CGTGCGACGAGATTCGCCCCGGCTATCGCAAGCTCTCGGCCGGGTCACACACGTTGTTCTATCGGGTGACTGGCGAAGGC
ACCATCGACGTCGTGCGAGTCCTGCACCAACGGATGGACGTCGACCGGAACCTCTGA

Antitoxin


Download         Length: 67 bp

>AT216258 NZ_CP083273:4493445-4493511 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References