Detailed information of TA system TA216258

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4493291..4493511
• Replicon: chromosome
• Accession: NZ_CP083273
• Organism: Escherichia coli strain BL21-RIPL

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: K9U36_RS21920
• Protein ID: WP_000170963.1
• Coordinates: 4493291..4493398 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4493445..4493511 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K9U36_RS21895	4488971..4489648	+	678	Protein_4299	RHS repeat-associated core domain-containing protein	-
K9U36_RS21900	4489648..4489974	+	327	WP_000873944.1	protein YbfB	-
K9U36_RS21905	4490076..4491088	-	1013	Protein_4301	IS3-like element IS150 family transposase	-
K9U36_RS21910	4491136..4492170	+	1035	Protein_4302	glutamate decarboxylase	-
K9U36_RS21915	4492109..4493200	-	1092	Protein_4303	elongation factor Tu	-
K9U36_RS21920	4493291..4493398	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4493445..4493511	+	67	-	-	Antitoxin
K9U36_RS21925	4493826..4493933	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4493981..4494046	+	66	NuclAT_17	-	-
-	4493981..4494046	+	66	NuclAT_17	-	-
-	4493981..4494046	+	66	NuclAT_17	-	-
-	4493981..4494046	+	66	NuclAT_17	-	-
-	4493981..4494046	+	66	NuclAT_20	-	-
-	4493981..4494046	+	66	NuclAT_20	-	-
-	4493981..4494046	+	66	NuclAT_20	-	-
-	4493981..4494046	+	66	NuclAT_20	-	-
-	4493981..4494046	+	66	NuclAT_23	-	-
-	4493981..4494046	+	66	NuclAT_23	-	-
-	4493981..4494046	+	66	NuclAT_23	-	-
-	4493981..4494046	+	66	NuclAT_23	-	-
-	4493981..4494046	+	66	NuclAT_26	-	-
-	4493981..4494046	+	66	NuclAT_26	-	-
-	4493981..4494046	+	66	NuclAT_26	-	-
-	4493981..4494046	+	66	NuclAT_26	-	-
-	4493981..4494046	+	66	NuclAT_29	-	-
-	4493981..4494046	+	66	NuclAT_29	-	-
-	4493981..4494046	+	66	NuclAT_29	-	-
-	4493981..4494046	+	66	NuclAT_29	-	-
-	4493981..4494046	+	66	NuclAT_32	-	-
-	4493981..4494046	+	66	NuclAT_32	-	-
-	4493981..4494046	+	66	NuclAT_32	-	-
-	4493981..4494046	+	66	NuclAT_32	-	-
-	4493981..4494048	+	68	NuclAT_35	-	-
-	4493981..4494048	+	68	NuclAT_35	-	-
-	4493981..4494048	+	68	NuclAT_35	-	-
-	4493981..4494048	+	68	NuclAT_35	-	-
-	4493981..4494048	+	68	NuclAT_38	-	-
-	4493981..4494048	+	68	NuclAT_38	-	-
-	4493981..4494048	+	68	NuclAT_38	-	-
-	4493981..4494048	+	68	NuclAT_38	-	-
-	4493981..4494048	+	68	NuclAT_41	-	-
-	4493981..4494048	+	68	NuclAT_41	-	-
-	4493981..4494048	+	68	NuclAT_41	-	-
-	4493981..4494048	+	68	NuclAT_41	-	-
-	4493981..4494048	+	68	NuclAT_44	-	-
-	4493981..4494048	+	68	NuclAT_44	-	-
-	4493981..4494048	+	68	NuclAT_44	-	-
-	4493981..4494048	+	68	NuclAT_44	-	-
-	4493981..4494048	+	68	NuclAT_47	-	-
-	4493981..4494048	+	68	NuclAT_47	-	-
-	4493981..4494048	+	68	NuclAT_47	-	-
-	4493981..4494048	+	68	NuclAT_47	-	-
-	4493981..4494048	+	68	NuclAT_50	-	-
-	4493981..4494048	+	68	NuclAT_50	-	-
-	4493981..4494048	+	68	NuclAT_50	-	-
-	4493981..4494048	+	68	NuclAT_50	-	-
-	4493982..4494047	+	66	NuclAT_53	-	-
-	4493982..4494047	+	66	NuclAT_53	-	-
-	4493982..4494047	+	66	NuclAT_53	-	-
-	4493982..4494047	+	66	NuclAT_53	-	-
-	4493982..4494047	+	66	NuclAT_56	-	-
-	4493982..4494047	+	66	NuclAT_56	-	-
-	4493982..4494047	+	66	NuclAT_56	-	-
-	4493982..4494047	+	66	NuclAT_56	-	-
K9U36_RS21930	4494270..4494377	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
K9U36_RS21935	4494753..4494860	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
K9U36_RS21940	4495117..4495814	+	698	WP_103215986.1	IS1-like element IS1A family transposase	-
K9U36_RS21945	4495830..4496477	+	648	Protein_4309	RHS element protein	-
K9U36_RS22135	4496469..4496603	+	135	Protein_4310	serum resistance lipoprotein Bor	-
K9U36_RS22140	4496635..4497135	-	501	WP_263300663.1	prophage endopeptidase RzpD	-
K9U36_RS21965	4497086..4497514	-	429	Protein_4312	ISAs1 family transposase	-
K9U36_RS21970	4497717..4497836	+	120	Protein_4313	IS3 family transposase	-
K9U36_RS21975	4497934..4498086	+	153	WP_000956455.1	type I toxin-antitoxin system toxin HokE	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	tufA	4476659..4496937	20278
	-	inside	IScluster/Tn	-	tufA	4473015..4497514	24499

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T216258 WP_000170963.1 NZ_CP083273:c4493398-4493291 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T216258 NZ_CP112997:c2198444-2198148 [Mycobacterium tuberculosis variant bovis]
GTGAGTAGCCGATACCTTCTCTCGCCTGCCGCGCAGGCACATCTGGAAGAGATCTGGGACTGCACCTATGACCGTTGGGG
TGTCGATCAGGCCGAGCAGTACCTGCGCGAACTTCAACACGCTATCGACCGTGCTGCGGCAAACCCGCGGATCGGACGAG
CGTGCGACGAGATTCGCCCCGGCTATCGCAAGCTCTCGGCCGGGTCACACACGTTGTTCTATCGGGTGACTGGCGAAGGC
ACCATCGACGTCGTGCGAGTCCTGCACCAACGGATGGACGTCGACCGGAACCTCTGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT216258 NZ_CP083273:4493445-4493511 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin