Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1693072..1693286 Replicon chromosome
Accession NZ_CP082835
Organism Escherichia coli strain 1613

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag K8O78_RS08290 Protein ID WP_000170963.1
Coordinates 1693072..1693179 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1693227..1693286 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K8O78_RS08260 (1688381) 1688381..1689463 + 1083 WP_000804726.1 peptide chain release factor 1 -
K8O78_RS08265 (1689463) 1689463..1690296 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
K8O78_RS08270 (1690293) 1690293..1690685 + 393 WP_000200379.1 invasion regulator SirB2 -
K8O78_RS08275 (1690689) 1690689..1691498 + 810 WP_001257044.1 invasion regulator SirB1 -
K8O78_RS08280 (1691534) 1691534..1692388 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
K8O78_RS08285 (1692536) 1692536..1692643 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1692696) 1692696..1692757 + 62 NuclAT_24 - -
- (1692696) 1692696..1692757 + 62 NuclAT_24 - -
- (1692696) 1692696..1692757 + 62 NuclAT_24 - -
- (1692696) 1692696..1692757 + 62 NuclAT_24 - -
- (1692696) 1692696..1692757 + 62 NuclAT_26 - -
- (1692696) 1692696..1692757 + 62 NuclAT_26 - -
- (1692696) 1692696..1692757 + 62 NuclAT_26 - -
- (1692696) 1692696..1692757 + 62 NuclAT_26 - -
- (1692696) 1692696..1692757 + 62 NuclAT_28 - -
- (1692696) 1692696..1692757 + 62 NuclAT_28 - -
- (1692696) 1692696..1692757 + 62 NuclAT_28 - -
- (1692696) 1692696..1692757 + 62 NuclAT_28 - -
- (1692696) 1692696..1692757 + 62 NuclAT_30 - -
- (1692696) 1692696..1692757 + 62 NuclAT_30 - -
- (1692696) 1692696..1692757 + 62 NuclAT_30 - -
- (1692696) 1692696..1692757 + 62 NuclAT_30 - -
- (1692696) 1692696..1692757 + 62 NuclAT_32 - -
- (1692696) 1692696..1692757 + 62 NuclAT_32 - -
- (1692696) 1692696..1692757 + 62 NuclAT_32 - -
- (1692696) 1692696..1692757 + 62 NuclAT_32 - -
- (1692696) 1692696..1692758 + 63 NuclAT_17 - -
- (1692696) 1692696..1692758 + 63 NuclAT_17 - -
- (1692696) 1692696..1692758 + 63 NuclAT_17 - -
- (1692696) 1692696..1692758 + 63 NuclAT_17 - -
- (1692696) 1692696..1692758 + 63 NuclAT_18 - -
- (1692696) 1692696..1692758 + 63 NuclAT_18 - -
- (1692696) 1692696..1692758 + 63 NuclAT_18 - -
- (1692696) 1692696..1692758 + 63 NuclAT_18 - -
- (1692696) 1692696..1692758 + 63 NuclAT_19 - -
- (1692696) 1692696..1692758 + 63 NuclAT_19 - -
- (1692696) 1692696..1692758 + 63 NuclAT_19 - -
- (1692696) 1692696..1692758 + 63 NuclAT_19 - -
- (1692696) 1692696..1692758 + 63 NuclAT_20 - -
- (1692696) 1692696..1692758 + 63 NuclAT_20 - -
- (1692696) 1692696..1692758 + 63 NuclAT_20 - -
- (1692696) 1692696..1692758 + 63 NuclAT_20 - -
- (1692696) 1692696..1692758 + 63 NuclAT_22 - -
- (1692696) 1692696..1692758 + 63 NuclAT_22 - -
- (1692696) 1692696..1692758 + 63 NuclAT_22 - -
- (1692696) 1692696..1692758 + 63 NuclAT_22 - -
- (1692696) 1692696..1692758 + 63 NuclAT_23 - -
- (1692696) 1692696..1692758 + 63 NuclAT_23 - -
- (1692696) 1692696..1692758 + 63 NuclAT_23 - -
- (1692696) 1692696..1692758 + 63 NuclAT_23 - -
K8O78_RS08290 (1693072) 1693072..1693179 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1693227) 1693227..1693286 + 60 NuclAT_25 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_25 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_25 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_25 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_27 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_27 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_27 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_27 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_29 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_29 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_29 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_29 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_31 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_31 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_31 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_31 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_33 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_33 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_33 - Antitoxin
- (1693227) 1693227..1693286 + 60 NuclAT_33 - Antitoxin
K8O78_RS08295 (1693578) 1693578..1694678 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
K8O78_RS08300 (1694948) 1694948..1695178 + 231 WP_001146444.1 putative cation transport regulator ChaB -
K8O78_RS08305 (1695339) 1695339..1696034 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
K8O78_RS08310 (1696078) 1696078..1696431 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
K8O78_RS08315 (1696617) 1696617..1698011 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T215370 WP_000170963.1 NZ_CP082835:c1693179-1693072 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T215370 NZ_CP110662:36008-36478 [Klebsiella pneumoniae]
GTGATCCTCTACAGGCTGACGAAAACAAAGTATCTTTCTACGGCCTGGACCGGATATGGTGCGAAAGAGGCTGGTGGGCG
CTGGAATAGCGTGGGGGTGTCAATGGTATATGTCTCCGAAACGGCATCACTAACGATGCTGGAGACGCTGGTACACCTGC
ATGCGGCACAGATAATGGACTCTTTCACTCTACTGAGTATCGATGTGCCTGATGAACTGATCCAAAGCGCAAACATGGAT
GAATTACCGGGCAACTGGGCTGATGAGGATGCGCCTCAGGAACTGGCTGATTACGGAGATGCCTGGTCATTTACCAGGAG
CTCGGTTGCACTGCGTGTTCCCTCAGCCTTATCGCCGGTAGAGTTCAATTATCTGTTAAATCCTGAGCACCCTGAGTTTT
ACGGGATTGTGCAGAAGGCTCAACAGATACCGTTCCGGTTTGATAGTCGTCTTAAACCTGACAGGAAGTGA

Antitoxin


Download         Length: 60 bp

>AT215370 NZ_CP082835:1693227-1693286 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References