Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 43827..44060 | Replicon | plasmid unnamed |
Accession | NZ_CP082832 | ||
Organism | Escherichia coli strain SCAID WND1-2021 (1/128) |
Toxin (Protein)
Gene name | hok | Uniprot ID | G9G195 |
Locus tag | K8B75_RS27055 | Protein ID | WP_001323520.1 |
Coordinates | 43944..44060 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 43827..43858 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8B75_RS27020 (39948) | 39948..40445 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
K8B75_RS27025 (40513) | 40513..40746 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
K8B75_RS27030 (40774) | 40774..40971 | + | 198 | Protein_54 | hypothetical protein | - |
K8B75_RS27035 (41026) | 41026..41460 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
K8B75_RS27040 (41457) | 41457..42219 | + | 763 | Protein_56 | plasmid SOS inhibition protein A | - |
K8B75_RS27045 (42188) | 42188..42376 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- (42188) | 42188..42385 | + | 198 | NuclAT_0 | - | - |
- (42188) | 42188..42385 | + | 198 | NuclAT_0 | - | - |
- (42188) | 42188..42385 | + | 198 | NuclAT_0 | - | - |
- (42188) | 42188..42385 | + | 198 | NuclAT_0 | - | - |
K8B75_RS27050 (42433) | 42433..43802 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- (43827) | 43827..43858 | + | 32 | NuclAT_3 | - | Antitoxin |
- (43827) | 43827..43858 | + | 32 | NuclAT_3 | - | Antitoxin |
- (43827) | 43827..43858 | + | 32 | NuclAT_3 | - | Antitoxin |
- (43827) | 43827..43858 | + | 32 | NuclAT_3 | - | Antitoxin |
K8B75_RS28320 (43844) | 43844..43993 | + | 150 | Protein_59 | plasmid maintenance protein Mok | - |
K8B75_RS27055 (43944) | 43944..44060 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
K8B75_RS28325 (44280) | 44280..44510 | + | 231 | WP_071886920.1 | hypothetical protein | - |
K8B75_RS28330 (44508) | 44508..44680 | - | 173 | Protein_62 | hypothetical protein | - |
K8B75_RS28335 (44750) | 44750..44956 | + | 207 | WP_000547968.1 | hypothetical protein | - |
K8B75_RS27060 (44981) | 44981..45268 | + | 288 | WP_000107535.1 | hypothetical protein | - |
K8B75_RS27065 (45386) | 45386..46207 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
K8B75_RS27070 (46504) | 46504..47106 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
K8B75_RS27075 (47427) | 47427..47810 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
K8B75_RS27080 (47997) | 47997..48686 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / mph(A) / sul1 / qacE / aadA5 | senB | 1..186443 | 186443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T215329 WP_001323520.1 NZ_CP082832:43944-44060 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
>T215329 NZ_CP110638:c5370190-5369807 [Klebsiella pneumoniae]
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
Antitoxin
Download Length: 32 bp
>AT215329 NZ_CP082832:43827-43858 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|