Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1871240..1871420 | Replicon | chromosome |
Accession | NZ_CP082815 | ||
Organism | Staphylococcus aureus strain SCAID WND1-2021 (598) |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | K8B78_RS08825 | Protein ID | WP_001801861.1 |
Coordinates | 1871240..1871335 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1871363..1871420 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8B78_RS08795 | 1866384..1867010 | + | 627 | WP_000669038.1 | hypothetical protein | - |
K8B78_RS08800 | 1867051..1867395 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
K8B78_RS08805 | 1867493..1868065 | + | 573 | WP_000414222.1 | hypothetical protein | - |
K8B78_RS08810 | 1868214..1869581 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
K8B78_RS08815 | 1869581..1870150 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
K8B78_RS08820 | 1870343..1870789 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
K8B78_RS08825 | 1871240..1871335 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1871363..1871420 | - | 58 | - | - | Antitoxin |
K8B78_RS08830 | 1871458..1871559 | + | 102 | WP_001791232.1 | hypothetical protein | - |
K8B78_RS08835 | 1871734..1872177 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
K8B78_RS08840 | 1872177..1872620 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
K8B78_RS08845 | 1872620..1873061 | - | 442 | Protein_1751 | DUF1433 domain-containing protein | - |
K8B78_RS08850 | 1873586..1876006 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T215180 WP_001801861.1 NZ_CP082815:1871240-1871335 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T215180 NZ_CP082815:1871240-1871335 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT215180 NZ_CP082815:c1871420-1871363 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|