Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2502533..2502717 | Replicon | chromosome |
| Accession | NC_007795 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | SAOUHSC_02721 | Protein ID | YP_501184.1 |
| Coordinates | 2502610..2502717 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2502533..2502593 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAOUHSC_A02577 | 2498063..2498230 | - | 168 | YP_501179.1 | hypothetical protein | - |
| SAOUHSC_02717 | 2498230..2498373 | - | 144 | YP_501180.1 | hypothetical protein | - |
| SAOUHSC_02718 | 2498461..2500194 | - | 1734 | YP_501181.1 | hypothetical protein | - |
| SAOUHSC_02719 | 2500219..2501982 | - | 1764 | YP_501182.1 | hypothetical protein | - |
| SAOUHSC_02720 | 2502476..2502583 | - | 108 | YP_501183.1 | hypothetical protein | - |
| - | 2502533..2502593 | + | 61 | - | - | Antitoxin |
| SAOUHSC_02721 | 2502610..2502717 | - | 108 | YP_501184.1 | hypothetical protein | Toxin |
| SAOUHSC_02722 | 2502851..2503237 | - | 387 | YP_501185.1 | hypothetical protein | - |
| SAOUHSC_02723 | 2503505..2504647 | + | 1143 | YP_501186.1 | glycerate kinase | - |
| SAOUHSC_02724 | 2504707..2505366 | + | 660 | YP_501187.1 | hypothetical protein | - |
| SAOUHSC_02725 | 2505548..2506759 | + | 1212 | YP_501188.1 | hypothetical protein | - |
| SAOUHSC_02726 | 2506882..2507355 | - | 474 | YP_501189.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T21496 YP_501184.1 NC_007795:c2502717-2502610 [Staphylococcus aureus subsp. aureus NCTC 8325]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T21496 NC_007795:c2502717-2502610 [Staphylococcus aureus subsp. aureus NCTC 8325]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT21496 NC_007795:2502533-2502593 [Staphylococcus aureus subsp. aureus NCTC 8325]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|