Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2211996..2212213 | Replicon | chromosome |
| Accession | NC_007795 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | SAOUHSC_02391 | Protein ID | YP_500868.1 |
| Coordinates | 2212109..2212213 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2211996..2212051 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAOUHSC_02386 | 2207609..2207833 | - | 225 | YP_500863.1 | hypothetical protein | - |
| SAOUHSC_02387 | 2208190..2208855 | - | 666 | YP_500864.1 | hypothetical protein | - |
| SAOUHSC_02388 | 2209007..2209327 | + | 321 | YP_500865.1 | hypothetical protein | - |
| SAOUHSC_02389 | 2209329..2210309 | + | 981 | YP_500866.1 | cation efflux family protein | - |
| SAOUHSC_02390 | 2210575..2211666 | + | 1092 | YP_500867.1 | lytic regulatory protein | - |
| - | 2211996..2212051 | + | 56 | - | - | Antitoxin |
| SAOUHSC_02391 | 2212109..2212213 | - | 105 | YP_500868.1 | hypothetical protein | Toxin |
| SAOUHSC_02393 | 2212900..2214036 | - | 1137 | YP_500870.1 | hypothetical protein | - |
| SAOUHSC_02394 | 2214325..2214417 | + | 93 | YP_500871.1 | hypothetical protein | - |
| SAOUHSC_02396 | 2215122..2215979 | - | 858 | YP_500873.1 | hypothetical protein | - |
| SAOUHSC_02397 | 2216047..2216829 | - | 783 | YP_500874.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T21494 YP_500868.1 NC_007795:c2212213-2212109 [Staphylococcus aureus subsp. aureus NCTC 8325]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T21494 NC_007795:c2212213-2212109 [Staphylococcus aureus subsp. aureus NCTC 8325]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT21494 NC_007795:2211996-2212051 [Staphylococcus aureus subsp. aureus NCTC 8325]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|