Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2098561..2098782 Replicon chromosome
Accession NZ_CP082774
Organism Escherichia coli O16:H6 strain CU37RT-2

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag K8B88_RS10075 Protein ID WP_000170963.1
Coordinates 2098561..2098668 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2098716..2098782 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K8B88_RS10050 (2094405) 2094405..2095487 + 1083 WP_000804726.1 peptide chain release factor 1 -
K8B88_RS10055 (2095487) 2095487..2096320 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
K8B88_RS10060 (2096317) 2096317..2096709 + 393 WP_000200375.1 invasion regulator SirB2 -
K8B88_RS10065 (2096713) 2096713..2097522 + 810 WP_001257054.1 invasion regulator SirB1 -
K8B88_RS10070 (2097558) 2097558..2098412 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
K8B88_RS10075 (2098561) 2098561..2098668 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2098718) 2098718..2098781 + 64 NuclAT_12 - -
- (2098718) 2098718..2098781 + 64 NuclAT_12 - -
- (2098718) 2098718..2098781 + 64 NuclAT_12 - -
- (2098718) 2098718..2098781 + 64 NuclAT_12 - -
- (2098718) 2098718..2098781 + 64 NuclAT_13 - -
- (2098718) 2098718..2098781 + 64 NuclAT_13 - -
- (2098718) 2098718..2098781 + 64 NuclAT_13 - -
- (2098718) 2098718..2098781 + 64 NuclAT_13 - -
- (2098718) 2098718..2098781 + 64 NuclAT_14 - -
- (2098718) 2098718..2098781 + 64 NuclAT_14 - -
- (2098718) 2098718..2098781 + 64 NuclAT_14 - -
- (2098718) 2098718..2098781 + 64 NuclAT_14 - -
- (2098718) 2098718..2098781 + 64 NuclAT_15 - -
- (2098718) 2098718..2098781 + 64 NuclAT_15 - -
- (2098718) 2098718..2098781 + 64 NuclAT_15 - -
- (2098718) 2098718..2098781 + 64 NuclAT_15 - -
- (2098718) 2098718..2098781 + 64 NuclAT_16 - -
- (2098718) 2098718..2098781 + 64 NuclAT_16 - -
- (2098718) 2098718..2098781 + 64 NuclAT_16 - -
- (2098718) 2098718..2098781 + 64 NuclAT_16 - -
- (2098718) 2098718..2098781 + 64 NuclAT_17 - -
- (2098718) 2098718..2098781 + 64 NuclAT_17 - -
- (2098718) 2098718..2098781 + 64 NuclAT_17 - -
- (2098718) 2098718..2098781 + 64 NuclAT_17 - -
- (2098716) 2098716..2098782 + 67 NuclAT_10 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_10 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_10 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_10 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_11 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_11 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_11 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_11 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_6 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_6 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_6 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_6 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_7 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_7 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_7 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_7 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_8 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_8 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_8 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_8 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_9 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_9 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_9 - Antitoxin
- (2098716) 2098716..2098782 + 67 NuclAT_9 - Antitoxin
- (2098718) 2098718..2098783 + 66 NuclAT_19 - -
- (2098718) 2098718..2098783 + 66 NuclAT_19 - -
- (2098718) 2098718..2098783 + 66 NuclAT_19 - -
- (2098718) 2098718..2098783 + 66 NuclAT_19 - -
- (2098718) 2098718..2098783 + 66 NuclAT_20 - -
- (2098718) 2098718..2098783 + 66 NuclAT_20 - -
- (2098718) 2098718..2098783 + 66 NuclAT_20 - -
- (2098718) 2098718..2098783 + 66 NuclAT_20 - -
- (2098718) 2098718..2098783 + 66 NuclAT_21 - -
- (2098718) 2098718..2098783 + 66 NuclAT_21 - -
- (2098718) 2098718..2098783 + 66 NuclAT_21 - -
- (2098718) 2098718..2098783 + 66 NuclAT_21 - -
- (2098718) 2098718..2098783 + 66 NuclAT_22 - -
- (2098718) 2098718..2098783 + 66 NuclAT_22 - -
- (2098718) 2098718..2098783 + 66 NuclAT_22 - -
- (2098718) 2098718..2098783 + 66 NuclAT_22 - -
- (2098718) 2098718..2098783 + 66 NuclAT_24 - -
- (2098718) 2098718..2098783 + 66 NuclAT_24 - -
- (2098718) 2098718..2098783 + 66 NuclAT_24 - -
- (2098718) 2098718..2098783 + 66 NuclAT_24 - -
- (2098718) 2098718..2098783 + 66 NuclAT_25 - -
- (2098718) 2098718..2098783 + 66 NuclAT_25 - -
- (2098718) 2098718..2098783 + 66 NuclAT_25 - -
- (2098718) 2098718..2098783 + 66 NuclAT_25 - -
K8B88_RS10080 (2099073) 2099073..2100173 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
K8B88_RS10085 (2100443) 2100443..2100673 + 231 WP_001146444.1 putative cation transport regulator ChaB -
K8B88_RS10090 (2100831) 2100831..2101526 + 696 WP_024187950.1 glutathione-specific gamma-glutamylcyclotransferase -
K8B88_RS10095 (2101570) 2101570..2101923 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
K8B88_RS10100 (2102108) 2102108..2103502 + 1395 WP_000086188.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T214924 WP_000170963.1 NZ_CP082774:c2098668-2098561 [Escherichia coli O16:H6]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T214924 NZ_CP110345:c156404-156123 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGTAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCCCTGAAAGCCGTCCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCTTTTCGGGTAAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA

Antitoxin


Download         Length: 67 bp

>AT214924 NZ_CP082774:2098716-2098782 [Escherichia coli O16:H6]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References