Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
Location | 764703..765112 | Replicon | chromosome |
Accession | NZ_CP082773 | ||
Organism | Escherichia coli O99:H6 strain CU42ET-1 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A3L4RJH9 |
Locus tag | K8B87_RS03600 | Protein ID | WP_001357525.1 |
Coordinates | 764703..765041 (-) | Length | 113 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 765036..765112 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8B87_RS03575 (760361) | 760361..761512 | - | 1152 | WP_001298064.1 | double-cubane-cluster-containing anaerobic reductase | - |
K8B87_RS03580 (761628) | 761628..762908 | - | 1281 | WP_012601894.1 | DUF445 domain-containing protein | - |
K8B87_RS03585 (763093) | 763093..764013 | + | 921 | WP_071342725.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
K8B87_RS03590 (764005) | 764005..764319 | - | 315 | Protein_685 | winged helix-turn-helix domain-containing protein | - |
K8B87_RS03595 (764497) | 764497..764661 | + | 165 | WP_001357524.1 | DUF1127 domain-containing protein | - |
K8B87_RS03600 (764703) | 764703..765041 | - | 339 | WP_001357525.1 | endoribonuclease SymE | Toxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_7 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_7 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_7 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_7 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_8 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_8 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_8 | - | Antitoxin |
- (765036) | 765036..765112 | + | 77 | NuclAT_8 | - | Antitoxin |
K8B87_RS03605 (765256) | 765256..765465 | - | 210 | Protein_688 | DUF3387 domain-containing protein | - |
K8B87_RS03610 (765694) | 765694..767544 | - | 1851 | WP_087603013.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
K8B87_RS03615 (767875) | 767875..768831 | - | 957 | WP_001314406.1 | GTPase | - |
K8B87_RS03620 (768842) | 768842..769045 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 764703..776526 | 11823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12314.03 Da Isoelectric Point: 7.8234
>T214889 WP_001357525.1 NZ_CP082773:c765041-764703 [Escherichia coli O99:H6]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
Download Length: 339 bp
>T214889 NZ_CP110309:c4458335-4458201 [Xanthomonas phaseoli pv. phaseoli]
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
Antitoxin
Download Length: 77 bp
>AT214889 NZ_CP082773:765036-765112 [Escherichia coli O99:H6]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|