Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hokW-rdlD/- |
Location | 3032168..3032393 | Replicon | chromosome |
Accession | NZ_CP082772 | ||
Organism | Escherichia coli O2:H1 strain HM670 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | K8B93_RS15035 | Protein ID | WP_000813254.1 |
Coordinates | 3032168..3032323 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3032335..3032393 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8B93_RS14980 | 3027248..3027562 | - | 315 | WP_000193273.1 | YdfR family protein | - |
K8B93_RS14985 | 3027567..3027782 | - | 216 | WP_000839572.1 | class II holin family protein | - |
K8B93_RS15010 | 3028507..3029220 | - | 714 | WP_000342820.1 | hypothetical protein | - |
K8B93_RS15015 | 3029466..3030287 | - | 822 | WP_001235237.1 | antitermination protein | - |
K8B93_RS15020 | 3030284..3030658 | - | 375 | WP_001217427.1 | RusA family crossover junction endodeoxyribonuclease | - |
K8B93_RS15025 | 3030671..3031720 | - | 1050 | WP_001265292.1 | DUF968 domain-containing protein | - |
K8B93_RS15030 | 3031722..3032000 | - | 279 | WP_024193993.1 | hypothetical protein | - |
K8B93_RS15035 | 3032168..3032323 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3032335..3032393 | + | 59 | - | - | Antitoxin |
K8B93_RS15040 | 3032561..3033226 | - | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
K8B93_RS15045 | 3033401..3033826 | - | 426 | WP_001151152.1 | DUF977 family protein | - |
K8B93_RS15050 | 3033867..3034937 | - | 1071 | WP_001262355.1 | hypothetical protein | - |
K8B93_RS15055 | 3035009..3035434 | - | 426 | WP_000693918.1 | toxin YdaT family protein | - |
K8B93_RS15060 | 3035418..3035690 | - | 273 | WP_000887447.1 | YdaS family helix-turn-helix protein | - |
K8B93_RS15065 | 3035800..3036201 | + | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
K8B93_RS15070 | 3036229..3036420 | + | 192 | WP_000100899.1 | hypothetical protein | - |
K8B93_RS15075 | 3036420..3036707 | + | 288 | WP_000936799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K8B93_RS15080 | 3036979..3037131 | + | 153 | WP_000379609.1 | DUF1391 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ybtS / ybtX / ybtQ / ybtP | 2999928..3052345 | 52417 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T214874 WP_000813254.1 NZ_CP082772:c3032323-3032168 [Escherichia coli O2:H1]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T214874 NZ_CP110301:65602-65880 [Xanthomonas citri pv. fuscans]
GTGCCGGCATTGGCTGATCTGGACGCAATCGCCGACTACATCGCAATCGATAACGCACCCGCTGCAGCGGCGCTGGTGAA
ACGGGTGTTCGCGCACGTTGAGCAATTGATTGAACACCCGGACAGCGGAAGCCGGCCACAGGAACTCAAGCGCTCGCGCT
ATCGCCAGATTGTCGAACCACCTTGCCGCGTGTTCTACCGCGTGGATGGGCAGCGCATCGTGGTGGTGCACGTAATGCGG
TCGGAGCGCGCGCTTCGCGGGAACCGTCTTTCACGCTGA
GTGCCGGCATTGGCTGATCTGGACGCAATCGCCGACTACATCGCAATCGATAACGCACCCGCTGCAGCGGCGCTGGTGAA
ACGGGTGTTCGCGCACGTTGAGCAATTGATTGAACACCCGGACAGCGGAAGCCGGCCACAGGAACTCAAGCGCTCGCGCT
ATCGCCAGATTGTCGAACCACCTTGCCGCGTGTTCTACCGCGTGGATGGGCAGCGCATCGTGGTGGTGCACGTAATGCGG
TCGGAGCGCGCGCTTCGCGGGAACCGTCTTTCACGCTGA
Antitoxin
Download Length: 59 bp
>AT214874 NZ_CP082772:3032335-3032393 [Escherichia coli O2:H1]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|